Recombinant Neosartorya fumigata Mitochondrial thiamine pyrophosphate carrier 1 (tpc1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be decided during production. If you have a specific tag type preference, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
tpc1; AFUA_2G14980; Mitochondrial thiamine pyrophosphate carrier 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
tpc1
Target Protein Sequence
MSAGGEHLKDEGTRRQVVLSGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDPASHHDVVG PIYKGTLSTMRTIIKQEGITGLWKGNIPAELMYVCYGALQFTAYRTTTQILAQLDPHRLP PALESFVSGAVAGGLATASTYPLDLLRTRFAAQGTERIYTSLLASVRDIARSEGPAGFFR GCSAAVGQIVPYMGLFFATYESLRPVLSGLENMPFGSGDAAAGVIASVLAKSGVFPLDLV RKRLQVQGPTRTLYVHRNIPEYRGVFSTIAMIVRTQGVRGLYRGLTVSLIKAAPASAITM WTYERSLKLLRDFRVAE
Uniprot No.

Target Background

Function
Mitochondrial transporter responsible for mediating the uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the thiamine pyrophosphate carrier TptA in Aspergillus fumigatus?

TptA is a mitochondrial membrane protein in Aspergillus fumigatus that functions as a transporter for thiamine pyrophosphate (ThPP), an essential cofactor for several mitochondrial enzymes. This protein shares approximately 28.61% amino acid identity with Saccharomyces cerevisiae Tpc1 . The protein is encoded by the AFUA_2G14980 gene on chromosome 2 of A. fumigatus and features a structure typical of mitochondrial carrier proteins with five predicted transmembrane helices (TM1-TM5) . Subcellular localization studies using GFP-tagged TptA have confirmed its mitochondrial localization through co-localization with MitoTracker Red .

How does TptA differ from other mitochondrial carriers?

While TptA belongs to the mitochondrial carrier family (MCF), it displays some distinct characteristics. Most MCF proteins contain three tandem repeat homologous domains of approximately 100 amino acids each and typically feature six transmembrane helices with N- and C-termini located in the intermembrane space . Interestingly, TptA appears to have only five predicted transmembrane helices (TM1-TM5) according to SMART protein search analysis, representing a structural variation from the typical MCF protein architecture . Despite this difference, functional studies demonstrate that TptA fully complements the S. cerevisiae tpc1 mutant, indicating conservation of function despite structural differences .

What is the relationship between TptA and fungal virulence?

Loss of the tptA gene results in attenuation of virulence in murine models of aspergillosis, establishing a clear link between thiamine pyrophosphate transport and A. fumigatus pathogenicity . The virulence attenuation likely stems from multiple factors, including the mutant's growth defects under iron-limited conditions that mimic the host environment during infection. Additionally, TptA influences the expression of hapX, a major transcription factor indispensable for adaptation to iron starvation . These findings suggest that targeting TptA could potentially disrupt both thiamine metabolism and iron adaptation mechanisms simultaneously, providing a multi-faceted approach to reducing fungal virulence.

How do mutations in conserved residues affect TptA function and fungal adaptation to low iron conditions?

Site-directed mutagenesis experiments have identified several conserved residues critical for TptA function. Specifically, mutations in Asp60 (D60A) and Gly153 (G153S) resulted in severe growth and conidiation defects on minimal media (MM) without ThPP supplementation, indicating these residues are essential for ThPP transport . Mutations in Arg53 (R53A), Lys255 (K255A), and Lys315 (K315A) led to milder growth defects, while the G205A mutation showed no discernible impact on growth compared to wild-type A. fumigatus .

The functional consequences of these mutations were further demonstrated in iron-limited conditions, as shown in the table below:

MutationGrowth on MM without ThPPGrowth on MM with ThPP (30 μM)Growth under iron-limited conditions
D60ASevere defectCompletely restoredSeverely impaired
G153SSevere defectCompletely restoredSeverely impaired
R53AMild defectCompletely restoredModerately impaired
K255AMild defectCompletely restoredModerately impaired
K315AMild defectCompletely restoredModerately impaired
G205ANo defectSimilar to wild-typeSimilar to wild-type
ΔtptASevere defectPartially restoredSeverely impaired

These results demonstrate that the same residues critical for ThPP transport are also required for adaptation to iron-limited conditions, establishing a mechanistic link between these two functions .

What is the regulatory relationship between TptA and HapX in iron homeostasis?

Research has revealed an unexpected regulatory relationship between TptA and HapX, a major transcription factor involved in iron homeostasis. Loss of tptA decreases the expression of hapX, which is indispensable for adaptation to iron starvation in A. fumigatus . This finding indicates that TptA acts upstream of HapX in the regulatory pathway controlling iron homeostasis.

Overexpression of hapX in the ΔtptA strain significantly rescued the growth defect and siderophore production by A. fumigatus in iron-depleted conditions . This genetic complementation experiment confirms that the iron starvation phenotype observed in the ΔtptA mutant is at least partially due to reduced HapX function. The mechanism by which a mitochondrial ThPP transporter influences the expression of a nuclear transcription factor remains incompletely understood, but likely involves retrograde signaling from mitochondria to the nucleus in response to altered metabolic states resulting from ThPP deficiency .

How does carbon source availability influence TptA-mediated adaptation to iron limitation?

TptA-mediated adaptation to low iron conditions displays a striking dependence on carbon sources. This relationship suggests that the metabolic pathways requiring ThPP as a cofactor are differentially activated depending on the available carbon substrate . The connection likely involves the ThPP-dependent enzymes acetolactate synthase (ALS), pyruvate dehydrogenase (PDH), and oxoglutarate dehydrogenase (OGDH), which function at key nodes in carbon metabolism .

What approaches can be used to study TptA localization and function in Aspergillus fumigatus?

Multiple complementary approaches have been successfully employed to study TptA localization and function:

  • Fluorescent protein tagging: C-terminal GFP fusion proteins expressed under native promoters have effectively demonstrated mitochondrial localization when co-stained with MitoTracker Red . This approach preserves physiological expression levels while allowing visualization of subcellular distribution.

  • Heterologous complementation: Expressing the S. cerevisiae tpc1 gene in ΔtptA mutants under the control of constitutive promoters (such as the A. nidulans gpdA promoter) has confirmed functional conservation between homologs . This approach can verify whether phenotypic defects are specifically due to loss of the transporter function.

  • Site-directed mutagenesis: Targeting conserved residues predicted to be involved in substrate binding or transport has identified amino acids critical for TptA function . The resulting mutants can be tested for growth with and without ThPP supplementation to determine the impact on transporter activity.

  • Isolation of mitochondria and transport assays: Though challenging in filamentous fungi, isolating mitochondria and performing in vitro transport assays with radiolabeled ThPP can provide direct evidence of transport activity and kinetics .

  • Phagosome isolation techniques: For studying interactions with host cells, magnetic latex beads coated with recombinant proteins can be used to isolate phagosomes and analyze associated proteins by immunoblotting .

How can researchers effectively generate and characterize tptA mutants in Aspergillus fumigatus?

Creating and characterizing tptA mutants requires several specialized approaches:

  • Agrobacterium-mediated transformation: This method has proven effective for generating insertional mutants with T-DNA integration, as demonstrated by the successful isolation of mutant T421 with T-DNA insertion 55 bp upstream of the tptA translational start site .

  • Targeted gene deletion: For complete functional analysis, generating a ΔtptA deletion mutant in an appropriate background strain (such as A1160 with Δku80, pyrG1 mutations) allows for clean phenotypic assessment . Confirmation should include both PCR and Southern blotting verification.

  • Complementation analysis: Reintroducing the wild-type tptA allele into mutant strains is essential to confirm that observed phenotypes result specifically from tptA disruption rather than secondary mutations or off-target effects .

  • Phenotypic characterization under various conditions:

    • Growth on minimal media with and without ThPP supplementation

    • Growth under iron-limited conditions (using chelators like bathophenanthroline disulfonate)

    • Assessment of conidiation (asexual sporulation)

    • Testing different carbon sources to assess metabolic dependencies

    • Virulence testing in appropriate animal models

  • Gene expression analysis: Real-time RT-PCR can be used to measure expression of iron-responsive genes like hapX to understand regulatory impacts of tptA disruption . For in vivo studies, lungs from infected mice can be harvested and processed for RNA extraction using the hot phenol method .

What experimental models are appropriate for studying the role of TptA in virulence and host-pathogen interactions?

Several experimental models have proven valuable for studying TptA's role in virulence:

  • Murine models of invasive aspergillosis:

    • Aerosol chamber inhalation model: This involves exposing mice to aerosolized conidia (2.4 × 10³ conidia per mouse) and provides a physiologically relevant infection route . This model is suitable for strains producing sufficient conidia for aerosolization.

    • Intranasal instillation model: For mutants with limited conidiation (like the ΔstuA mutant), intranasal instillation of 5 × 10⁵ conidia in a 25-μl volume provides an alternative infection route . This approach ensures delivery of a consistent inoculum.

  • Cell culture models:

    • A549 human lung epithelial cells: These cells have been successfully used to study internalization and intracellular processing of A. fumigatus conidia . Approximately 12-15% of conidia are typically internalized after 8 hours of incubation.

    • Phagocyte interaction models: Using macrophages or neutrophils to study phagosome maturation and fungal survival can provide insights into immune evasion mechanisms .

  • Phagosome isolation and analysis:

    • Magnetic latex beads coated with recombinant proteins can be used to isolate and analyze phagosomes . For example, beads coated with recombinant HscA (rHscA) or Hsp70 (rHsp70) have been used to study protein interactions on phagosomal membranes.

  • Gene expression analysis from infected tissues:

    • RNA extraction from infected mouse lungs followed by real-time RT-PCR allows quantification of fungal gene expression during infection . This technique can track developmental stages of the fungus in vivo based on marker gene expression patterns.

How might understanding TptA function inform therapeutic strategies for invasive aspergillosis?

The discovery that TptA is essential for both thiamine metabolism and adaptation to iron limitation presents multiple therapeutic opportunities. Targeting TptA could simultaneously disrupt two critical aspects of A. fumigatus pathogenicity . Several potential therapeutic approaches emerge from this research:

  • Direct inhibitors of TptA transport function: Small molecules designed to bind conserved residues like Asp60 or Gly153 could block ThPP transport without affecting human mitochondrial carriers, provided sufficient selectivity can be achieved .

  • Exploitation of iron-thiamine metabolic crosstalk: Combination therapies targeting both iron acquisition and thiamine metabolism could synergistically impair fungal growth in the iron-limited host environment .

  • Host-directed therapies: Given that host proteins like p11 (S100A10) play roles in fungal phagosome processing, modulating host factors could complement direct antifungal approaches . For example, a single nucleotide polymorphism in the non-coding region of the S100A10 (p11) gene affects susceptibility to invasive aspergillosis .

  • Carbon source-dependent metabolic vulnerabilities: The observation that TptA-mediated adaptation to iron limitation depends on carbon sources suggests that metabolic inhibitors could be particularly effective when targeting specific metabolic states of the fungus .

What is known about the structural basis of substrate specificity in mitochondrial thiamine pyrophosphate carriers?

The structural basis of substrate specificity in mitochondrial ThPP carriers is beginning to emerge from mutational analyses. Key insights include:

  • Conserved residues crucial for transport: Asp60, Gly153, Arg53, Lys255, and Lys315 have been identified as important for ThPP transport, with mutations in these residues resulting in varying degrees of functional impairment . These residues likely form part of the substrate binding pocket or contribute to conformational changes during transport.

  • Transmembrane domain organization: Unlike typical mitochondrial carriers with six transmembrane helices, TptA appears to have five predicted transmembrane segments (TM1-TM5) . This structural difference may contribute to its specific recognition of ThPP versus other phosphorylated compounds.

  • Functional complementation across species: Despite only 28.61% sequence identity between A. fumigatus TptA and S. cerevisiae Tpc1, the S. cerevisiae protein can functionally complement the A. fumigatus ΔtptA mutant . This suggests conservation of critical structural features required for ThPP binding and transport despite sequence divergence.

  • Partial functional restoration by high ThPP concentrations: While point mutations in specific residues (D60A, G153S, R53A, K255A, K315A) can be completely rescued by ThPP supplementation, the complete deletion mutant (ΔtptA) shows only partial restoration under the same conditions . This suggests that beyond the substrate binding site, other regions of the protein are essential for proper transport function.

How does the TptA-HapX regulatory axis integrate with broader stress response pathways in Aspergillus fumigatus?

The unexpected regulatory relationship between TptA and HapX represents a novel connection between thiamine metabolism and iron homeostasis. This relationship likely integrates with broader stress response networks in A. fumigatus:

  • Metabolic signaling to nuclear transcription factors: The reduced expression of hapX in ΔtptA mutants suggests that mitochondrial metabolic status influences nuclear gene expression through retrograde signaling pathways . This could involve metabolic intermediates, reactive oxygen species, or specific signaling proteins.

  • Convergence with other stress response pathways: Iron starvation adaptation requires coordinated responses involving not only HapX but also other transcription factors like SreA (iron-responsive GATA factor) . The observation that TptA influences this network suggests potential integration with multiple stress response pathways.

  • Carbon source-dependent regulation: The finding that TptA-mediated adaptation to iron limitation depends on carbon sources points to integration with carbon metabolism regulatory networks . This may involve sensing of metabolic intermediates or energy status that varies with carbon source.

  • Potential integration with developmental programs: Research on A. fumigatus developmental gene expression has identified distinct patterns for precompetence genes (hsp70, ura7) versus developmental regulator genes (stuA, sspA) . How TptA function integrates with these developmental programs remains to be fully explored.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.