Recombinant Neosartorya fumigata NADH-cytochrome b5 reductase 1 (cbr1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If a specific tag type is required, please inform us, and we will prioritize its use.
Synonyms
cbr1; AFUA_2G14060; NADH-cytochrome b5 reductase 1; Microsomal cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
cbr1
Target Protein Sequence
MSALSSENINGVYIPSALLLFGTFIVKKEFVPYAVAVTAILAGLKLFTGGNKPRKVLNPT EFQEFVLKEKIDVSHNVCIYRFALPRPTDILGLPIGQHISLAATIEGQPKEVVRSYTPIS SDNEAGYFDLLVKAYPQGNISKYLTTLKIGDTMKVRGPKGAMVYTPNMCRHIGMIAGGTG ITPMLQIIKAVIRNRPRNGGNDTTKLDLIFANVNPDDILLKEELDMLAAEDPDFNIYYVL NNPPQGWTGGVGFVTPEMIKEHLPAPASDVKILLCGPPPMISAMKKATESLGYTKARPVS KLEDQVFCF
Uniprot No.

Target Background

Function
Recombinant *Neosartorya fumigata* NADH-cytochrome b5 reductase 1 (cbr1) functions as an electron donor reductase for cytochrome b5. The cytochrome b5/NADH cytochrome b5 reductase electron transfer system is essential for the catalytic activity of several sterol biosynthetic enzymes.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is NADH-cytochrome b5 reductase and what is its primary function?

NADH-cytochrome b5 reductase (b5R) is a flavoprotein that consists of two primary structural domains: an NADH binding domain and a flavin adenine dinucleotide (FAD) binding domain. Its core function is to catalyze electron transfer from the two-electron carrier NADH to the one-electron carrier cytochrome b5 (Cb5). This electron transfer process is fundamental to numerous metabolic pathways in both mammalian and fungal systems .

The catalytic mechanism involves the reduction of FAD by NADH, followed by the sequential transfer of single electrons to cytochrome b5. This process is facilitated by conformational changes between the oxidized and reduced states of the enzyme, which optimize the geometry for efficient electron transfer.

How does CBR1 differ from traditional NADH-cytochrome b5 reductase?

While both enzymes are involved in redox reactions, they exhibit distinct substrate preferences and cofactor requirements:

FeatureCBR1NADH-cytochrome b5 reductase
Cofactor preferenceNADPH-dependentNADH-dependent
Substrate rangeBroad (carbonyl compounds, quinones, xenobiotics)Specific (cytochrome b5)
Primary reactionReduction of carbonyl compoundsElectron transfer to cytochrome b5
Cellular localizationCytosolicMembrane-associated and soluble forms

CBR1 functions as an NADPH-dependent reductase with broad substrate specificity, catalyzing the reduction of various carbonyl compounds including quinones, prostaglandins, and xenobiotics . In contrast, NADH-cytochrome b5 reductase has a more specialized role in the electron transport chain, utilizing NADH as its preferred electron donor .

What is the relationship between Neosartorya fumigata and Aspergillus fumigatus?

Neosartorya fumigata is the teleomorph (sexual form) of Aspergillus fumigatus, which is the anamorph (asexual form). These are two names for the same organism at different life cycle stages. In recent taxonomic classifications, Aspergillus fumigatus is the preferred nomenclature, but older literature may refer to the organism as Neosartorya fumigata, particularly when discussing the sexual reproductive phase.

In the context of pathogenicity research, Aspergillus fumigatus is recognized as an opportunistic human pathogen that can cause invasive pulmonary aspergillosis in immunocompromised individuals . The protein expression patterns, including expression of metabolic enzymes like NADH-cytochrome b5 reductase, may differ between the sexual and asexual forms of the organism.

What experimental approaches are most effective for purifying recombinant fungal CBR1?

When purifying recombinant fungal CBR1, the following methodological approach has proven effective:

  • Expression system selection: Escherichia coli BL21(DE3) is often used for heterologous expression due to its high yield and ease of genetic manipulation. For fungal proteins requiring post-translational modifications, Pichia pastoris may be preferable.

  • Vector optimization: Incorporating a His-tag or GST-tag facilitates purification while minimizing interference with enzymatic activity.

  • Culture conditions: Induction with IPTG at lower temperatures (16-18°C) often improves soluble protein yield for fungal proteins.

  • Purification protocol:

    • Initial capture via affinity chromatography (Ni-NTA for His-tagged proteins)

    • Intermediate purification using ion exchange chromatography

    • Polishing step with size exclusion chromatography to achieve >95% purity

  • Quality assessment: SDS-PAGE, Western blotting, and enzymatic activity assays should be performed to confirm identity and functionality .

This approach typically yields purified recombinant protein suitable for structural and functional studies.

How do conformational changes in NADH-cytochrome b5 reductase affect its electron transfer capabilities?

Research on NADH-cytochrome b5 reductase reveals significant conformational differences between the oxidized and reduced states that directly impact electron transfer efficiency. Crystal structure analyses at high resolution (1.68Å) demonstrate that the relative configuration of the NADH and FAD binding domains undergoes a subtle but crucial shift during the redox cycle .

In the reduced form of b5R, this conformational change results in:

  • An increased solvent-accessible surface area of the FAD cofactor, which facilitates interaction with electron acceptors

  • The formation of a new hydrogen-bonding interaction between the N5 atom of the isoalloxazine ring of FAD and the hydroxyl oxygen atom of Thr66

  • Optimal positioning of Thr66, which serves as a key residue in the release of a proton from the N5 atom of FAD

These structural alterations collectively enhance the enzyme's ability to transfer electrons from NADH to cytochrome b5. Researchers investigating fungal b5R should consider these conformational dynamics when designing inhibitors or studying catalytic mechanisms, as the transient states may expose unique binding pockets or functional motifs.

What methodologies are recommended for characterizing genetic polymorphisms in fungal NADH-cytochrome b5 reductase?

Based on approaches used for human cytochrome b5 reductase, the following comprehensive methodology is recommended for characterizing genetic polymorphisms in fungal systems:

  • Genomic analysis:

    • PCR amplification and sequencing of the coding regions of the fungal b5R gene

    • Comparison with reference sequences to identify SNPs

    • Annotation of non-synonymous mutations that might affect protein function

  • Expression analysis:

    • Quantitative RT-PCR to assess mRNA expression levels of different variants

    • Western blotting with semi-quantification to determine protein expression levels

  • Functional characterization:

    • Microsomal assays to measure enzymatic activity with model substrates

    • Kinetic analysis to determine Vmax, Km, and catalytic efficiency (Vmax/Km)

    • Assessment of substrate specificity profiles for each variant

  • Structural impact assessment:

    • In silico modeling of protein structures with identified mutations

    • Molecular dynamics simulations to predict effects on protein stability and function

Studies with human b5R have demonstrated that even single amino acid substitutions (such as R59H and R297H) can significantly alter enzymatic kinetics and catalytic efficiency, highlighting the importance of comprehensive characterization .

How can researchers design experiments to distinguish between NADH-dependent and NADPH-dependent activities in fungal reductases?

Distinguishing between NADH and NADPH dependency in fungal reductases requires careful experimental design:

Step 1: Define Variables

  • Independent variable: Cofactor type (NADH vs. NADPH)

  • Dependent variable: Enzyme activity (typically measured by substrate conversion rate)

  • Control variables: pH, temperature, substrate concentration, enzyme concentration

Step 2: Experimental Protocol Design

  • Parallel assays: Conduct identical reactions substituting either NADH or NADPH at equimolar concentrations.

  • Kinetic analysis: Determine Vmax and Km values for each cofactor to assess preference.

  • Inhibition studies: Use specific inhibitors of NADH or NADPH binding to confirm dependency.

  • Spectrophotometric monitoring: Track cofactor oxidation at appropriate wavelengths (340 nm).

Step 3: Data Analysis

  • Calculate the ratio of activity with NADH versus NADPH under standardized conditions

  • Determine the catalytic efficiency (kcat/Km) with each cofactor

  • Compare pH optima for activity with each cofactor, as they often differ

Validation Approach:
Site-directed mutagenesis of putative cofactor binding residues can confirm the structural basis for cofactor preference. Residues that interact with the 2'-phosphate of NADPH are particularly informative targets.

This methodological approach enables clear discrimination between NADH-dependent enzymes like cytochrome b5 reductase and NADPH-dependent enzymes like carbonyl reductase .

What role might NADH-cytochrome b5 reductase play in Aspergillus fumigatus pathogenicity?

Though direct evidence for NADH-cytochrome b5 reductase's role in A. fumigatus pathogenicity is limited, several mechanisms can be proposed based on our understanding of fungal pathogenesis:

  • Redox homeostasis during host-pathogen interaction: NADH-cytochrome b5 reductase may contribute to maintaining redox balance when the fungus encounters oxidative stress in the host environment. This could enhance survival within phagocytes.

  • Modification of host defense molecules: Similar to how A. fumigatus modifies host phagosome maturation through surface proteins , b5 reductase could potentially modify host defense molecules through its redox activity.

  • Xenobiotic metabolism: The enzyme might participate in detoxification pathways that neutralize host antimicrobial compounds, similar to how human b5R and b5 catalyze the reduction of sulfamethoxazole hydroxylamine .

  • Cell wall integrity: Electron transfer systems often support biosynthetic pathways involved in cell wall maintenance, which is crucial for fungal pathogenicity.

Research suggests that A. fumigatus employs sophisticated mechanisms to evade host immune responses, including redirection of phagosome maturation pathways . Investigating whether NADH-cytochrome b5 reductase participates in these processes could reveal new therapeutic targets.

How do structural differences between human and fungal cytochrome b5 reductases impact inhibitor development?

Developing selective inhibitors for fungal NADH-cytochrome b5 reductase requires thorough understanding of structural differences between human and fungal enzymes:

FeatureHuman b5 ReductaseFungal b5 ReductaseImplications for Inhibitor Design
FAD binding domainConserved but with human-specific residuesContains fungal-specific residuesTarget fungal-specific regions near the FAD binding site
NADH binding pocketOften more closed conformationGenerally more accessibleDesign inhibitors that exploit differences in pocket geometry
Surface charge distributionDistinct electrostatic profileUnique charge patternsDevelop compounds with complementary charge distributions
Allosteric sitesPresent but may differ in locationMay contain unique regulatory sitesTarget fungal-specific allosteric sites
Membrane associationContains membrane-binding domainsMay have different membrane interaction motifsConsider membrane penetration in inhibitor design

The conformational changes that occur during the catalytic cycle, particularly the shift in domain orientation and solvent accessibility of FAD observed in the reduced state , present potential opportunities for selective inhibition. Compounds that can lock the fungal enzyme in a non-productive conformation without affecting the human ortholog would be promising candidates for antifungal development.

Additionally, understanding genetic polymorphisms in the fungal enzyme could inform the development of inhibitors that maintain efficacy across strain variations .

What experimental design is recommended for studying the impact of environmental factors on fungal NADH-cytochrome b5 reductase expression and activity?

A robust experimental design for investigating environmental influences on fungal NADH-cytochrome b5 reductase should follow these key steps:

Step 1: Defining Variables

  • Independent variables: Environmental factors (pH, temperature, oxygen concentration, nutrient availability, antifungal exposure)

  • Dependent variables: Enzyme expression levels and enzymatic activity

  • Control variables: Growth phase, genetic background

Step 2: Experimental Setup

  • Culture A. fumigatus under systematically varied environmental conditions

  • Extract protein and RNA at defined time points

  • Perform parallel analyses of:

    • Transcript levels (qRT-PCR)

    • Protein expression (Western blotting)

    • Enzyme activity (spectrophotometric assays)

Step 3: Advanced Analyses

  • Proteomics to identify post-translational modifications induced by environmental stress

  • Metabolomics to correlate enzyme activity with metabolic changes

  • In vivo imaging with fluorescently tagged enzyme to track localization under different conditions

Data Integration Approach: Implement multivariate statistical analysis to identify correlations between environmental factors and enzyme parameters. This comprehensive approach would reveal how A. fumigatus adapts its redox systems to different host microenvironments during infection, potentially identifying conditions that could be therapeutically exploited.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.