Recombinant Neosartorya fumigata NADH-cytochrome b5 reductase 2 (mcr1)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Neosartorya fumigata NADH-cytochrome b5 reductase 2 (Mcr1) is a protein expressed in E. coli and fused to an N-terminal His tag . Mcr1, encoded by the gene mcr1, functions as NADH-cytochrome b5 reductase 2 in Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355), now known as Neosartorya fumigata .

Basic Information

CharacteristicDescription
NameRecombinant Full Length Neosartorya fumigata NADH-cytochrome b5 reductase 2(mcr1) Protein, His-Tagged
SourceE. coli
TagHis
Protein LengthFull Length (1-323)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
AA SequenceMFARQSLRVAQPLKQGFRKYSTEAPSKGKSSLAPIYLGVGLIGLGVGLYRYNSASAEAPPERPKVFTGGDQGWVDLKLAQIENLSPNTKRLRFEFPDKEAVSGLHVASALLTKFKPQGAEKPVIRPYTPVSDEEQPGYLDLVVKVYPNGPMSEHLHSMNVDQRLEFKGPIPKYPWEANKHKHICLIAGGTGITPMYQLARKIFKDPEDQTKVTLVFGNVREEDILLKKELEELENTYPRRFRAFYLLDHPPKEWTGGKGYITKELLKTVLPEPKEENIKIFVCGPPGMYKSISGPKVSPTDQGELTGILAELGYSKDQVFKF

Function and Significance

The NADH-cytochrome b5 reductase system is involved in electron transfer, which is crucial for various metabolic processes. This system can efficiently support sterol 14alpha-demethylation, an important step in ergosterol production, in conjunction with cytochrome b5 .

Neosartorya pseudofischeri Misidentification

Neosartorya pseudofischeri can be misidentified as A. fumigatus due to overlapping phenotypic characteristics . Molecular typing, such as sequencing the β-tubulin (benA) and rodlet A (rodA) genes, is essential for accurate identification .

Antifungal Susceptibility

Neosartorya pseudofischeri isolates may exhibit different antifungal susceptibility patterns compared to A. fumigatus. For example, N. pseudofischeri isolates often show higher MICs (minimum inhibitory concentrations) to voriconazole .

Table of Antifungal Susceptibility

IsolateAmphotericin B (μg/ml)Itraconazole (μg/ml)Voriconazole (μg/ml)Caspofungin a
N. pseudofischeri FH2740.5120.015
A. thermomutatus FH2402140.03
A. thermomutatus FH2421120.03
A. fumigatus Af2930.50.50.250.125

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mcr1; AFUA_1G04540; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-323
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
mcr1
Target Protein Sequence
MFARQSLRVAQPLKQGFRKYSTEAPSKGKSSLAPIYLGVGLIGLGVGLYRYNSASAEAPP AERPKVFTGGDQGWVDLKLAQIENLSPNTKRLRFEFPDKEAVSGLHVASALLTKFKPQGA EKPVIRPYTPVSDEEQPGYLDLVVKVYPNGPMSEHLHSMNVDQRLEFKGPIPKYPWEANK HKHICLIAGGTGITPMYQLARKIFKDPEDQTKVTLVFGNVREEDILLKKELEELENTYPR RFRAFYLLDHPPKEWTGGKGYITKELLKTVLPEPKEENIKIFVCGPPGMYKSISGPKVSP TDQGELTGILAELGYSKDQVFKF
Uniprot No.

Target Background

Function
May mediate the reduction of outer membrane cytochrome b5.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is Neosartorya fumigata and how does it relate to Aspergillus fumigatus?

Neosartorya fumigata is the teleomorph (sexual form) of Aspergillus fumigatus, belonging to the Aspergillus section Fumigati subgenus Fumigati. Genetic-based methods have revealed that organisms phenotypically identified as A. fumigatus actually constitute a mold complex. Unlike typical A. fumigatus infections, those caused by Neosartorya species tend to be more chronic, with a median duration of 35 weeks compared to 5.5 weeks for infections caused by A. fumigatus sensu stricto in patients with chronic granulomatous disease . Molecular identification of these fungi requires multilocus sequencing analysis focusing on regions such as internal transcribed spacer (ITS) regions of ribosomal DNA, β-tubulin, and rodlet A genes .

What are the optimal conditions for reconstitution and storage of recombinant mcr1 protein?

Recombinant mcr1 protein is typically supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, the addition of 5-50% glycerol (with 50% being standard) is recommended before aliquoting and storing at -20°C/-80°C .

To minimize protein degradation:

  • Briefly centrifuge the vial prior to opening

  • Avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for no more than one week

  • Store reconstituted protein in Tris/PBS-based buffer containing 6% trehalose at pH 8.0

What are the best expression systems for producing recombinant Neosartorya fumigata mcr1?

E. coli has been successfully used as an expression system for recombinant Neosartorya fumigata NADH-cytochrome b5 reductase 2 . When designing expression protocols, researchers should consider:

  • Codon optimization: Adjusting the coding sequence to match E. coli codon usage preferences

  • Fusion tags: Utilizing N-terminal His tags for simplified purification

  • Solubility enhancement: Including solubility-enhancing fusion partners if expression yields insoluble protein

  • Expression conditions: Optimizing temperature, IPTG concentration, and induction timing

The standard approach involves cloning the mcr1 gene into an appropriate expression vector with a His-tag sequence, transforming competent E. coli cells, inducing protein expression, followed by cell lysis and purification using nickel affinity chromatography.

How can researchers verify the purity and activity of recombinant mcr1 preparations?

A multi-faceted approach to quality control includes:

  • SDS-PAGE analysis: Verify protein size (approximately 37-40 kDa with His-tag) and purity (should exceed 90%)

  • Western blotting: Confirm identity using anti-His antibodies or specific anti-mcr1 antibodies

  • Enzymatic activity assay: Measure NADH oxidation spectrophotometrically at 340 nm in the presence of appropriate electron acceptors

  • Mass spectrometry: Confirm protein mass and sequence coverage

  • Circular dichroism: Assess proper protein folding and secondary structure

For activity assays, researchers should prepare the following reaction mixture:

  • 50 mM potassium phosphate buffer, pH 7.0

  • 0.1 mM NADH

  • 10 μM cytochrome b5

  • Recombinant mcr1 enzyme (1-10 μg/mL)

Activity can be calculated as μmol NADH oxidized per minute per mg of enzyme using an extinction coefficient of 6,220 M⁻¹cm⁻¹.

What approaches can be used to study the subcellular localization of mcr1 in Neosartorya fumigata?

To investigate subcellular localization, researchers can employ:

  • Fluorescent protein fusion: Creating GFP-mcr1 constructs for expression in N. fumigata

  • Immunofluorescence microscopy: Using specific antibodies against mcr1

  • Subcellular fractionation: Isolating mitochondria and other cellular components followed by Western blotting

  • Electron microscopy with immunogold labeling: For high-resolution localization studies

Protocol considerations should account for the unique cell wall composition of filamentous fungi, which may require specialized permeabilization techniques for immunolocalization studies or transformation protocols for expressing fusion proteins.

How can researchers investigate the role of mcr1 in Neosartorya fumigata pathogenicity?

To explore mcr1's potential role in pathogenicity, researchers can implement:

  • Gene knockout studies: Using CRISPR-Cas9 or homologous recombination to create mcr1-deficient mutants

  • Virulence assays: Comparing wild-type and mcr1-knockout strains in appropriate infection models

  • Comparative proteomics: Analyzing protein expression changes in response to host-mimicking conditions

  • Metabolic flux analysis: Investigating changes in electron transport and redox homeostasis

When designing these studies, researchers should consider that invasive aspergillosis due to Neosartorya species exhibits distinct clinical manifestations compared to typical Aspergillus infections, including more chronic disease progression and potential resistance to standard therapy .

What is the evolutionary relationship between mcr1 in Neosartorya fumigata and related enzymes in other Aspergillus species?

Comparative evolutionary analysis can be approached through:

  • Phylogenetic analysis: Constructing phylogenetic trees based on mcr1 sequences from different Aspergillus and Neosartorya species

  • Synteny mapping: Analyzing gene arrangement and conservation in genomic contexts

  • Selective pressure analysis: Calculating Ka/Ks ratios to identify regions under purifying or positive selection

  • Structural modeling: Comparing protein structures to identify conserved functional domains

Genome comparisons between Neosartorya species have revealed syntenic relationships over extended genomic regions, as demonstrated by the 23,300 bp syntenic region between N. fischeri MAT1 and A. fumigatus MAT locus . Similar approaches could be applied to study mcr1 evolution.

How does the structure-function relationship of mcr1 compare to other cytochrome b5 reductases?

Investigating structure-function relationships requires:

  • Protein crystallization: Determining the three-dimensional structure of mcr1

  • Site-directed mutagenesis: Creating variants with modifications in key residues

  • Functional assays: Measuring the impact of mutations on enzyme kinetics

  • Molecular dynamics simulations: Modeling protein-substrate interactions

The mcr1 sequence contains domains characteristic of cytochrome b5 reductases, including:

  • NADH-binding domain (FAD-binding region)

  • Cytochrome b5 binding interface

  • Membrane association domains

What are common challenges in expressing and purifying active mcr1 protein?

Researchers frequently encounter these challenges:

  • Protein solubility: mcr1 may form inclusion bodies in E. coli expression systems

  • Protein activity loss: Improper folding or cofactor incorporation

  • Proteolytic degradation: Breakdown during expression or purification

  • Low yield: Insufficient protein production for downstream applications

Troubleshooting approaches:

ChallengeSolution Strategy
Inclusion bodiesLower induction temperature (16-20°C), use solubility tags (SUMO, MBP), or optimize refolding protocols
Activity lossInclude FAD in purification buffers, optimize buffer composition with reducing agents
DegradationAdd protease inhibitors, reduce purification time, maintain cold temperatures
Low yieldOptimize codon usage, change promoter strength, increase culture volume

How can researchers address specificity concerns when studying mcr1 in complex fungal systems?

When investigating mcr1 function in Neosartorya fumigata:

  • Generate knockout controls: Create and validate mcr1 deletion strains

  • Use specific antibodies: Develop and validate antibodies that don't cross-react with other reductases

  • Design specific primers: For RT-qPCR studies to ensure targeting only mcr1

  • Implement complementation studies: Reintroduce wild-type or mutant mcr1 to confirm phenotype specificity

Researchers should note that proper species identification is critical, as fungi morphologically identified as A. fumigatus may actually be Neosartorya species with different biological properties and drug susceptibilities .

What methodological approaches can help distinguish between direct and indirect effects of mcr1 in experimental systems?

To differentiate direct from indirect effects:

  • Temporal studies: Monitor changes immediately following mcr1 inhibition or activation

  • Dose-response experiments: Correlate mcr1 activity levels with observed phenotypes

  • Rescue experiments: Test if supplementing potential downstream products rescues mcr1 deficiency

  • Interaction studies: Use pull-down assays or two-hybrid screens to identify direct protein partners

  • In vitro reconstitution: Assemble minimal systems with purified components to verify direct effects

These approaches are particularly important when studying redox enzymes like mcr1, which may have broad metabolic impacts that can confound interpretation of phenotypic studies.

How might mcr1 contribute to antifungal resistance in Neosartorya species?

Investigating potential roles in drug resistance:

  • Comparative expression analysis: Measure mcr1 expression in drug-resistant vs. susceptible isolates

  • Drug-protein interaction studies: Assess direct interactions between antifungals and mcr1

  • Redox state analysis: Examine how mcr1 activity affects cellular redox balance during drug exposure

  • Combination therapy testing: Evaluate if inhibiting mcr1 increases susceptibility to conventional antifungals

This research is particularly relevant as Neosartorya species have shown relatively higher minimum inhibitory concentrations to various antifungal agents compared to A. fumigatus sensu stricto isolates .

What potential exists for developing mcr1-targeted therapeutics against invasive Neosartorya infections?

Exploring mcr1 as a therapeutic target requires:

  • Essential function verification: Determine if mcr1 is essential for fungal viability or virulence

  • Selective inhibitor screening: Identify compounds that inhibit fungal mcr1 but not human homologs

  • Structure-based drug design: Use protein structures to design specific inhibitors

  • In vivo efficacy testing: Evaluate candidate inhibitors in appropriate infection models

Given that Neosartorya infections can be chronic and refractory to standard therapy, with disease spreading across anatomical planes in a contiguous manner , new therapeutic targets could significantly improve treatment outcomes.

How can systems biology approaches enhance our understanding of mcr1's role in fungal metabolism?

Integrative approaches to study mcr1 include:

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data

  • Flux balance analysis: Modeling metabolic networks with varying mcr1 activity

  • Protein-protein interaction networks: Mapping mcr1's position in cellular interaction webs

  • Comparative systems analysis: Examining differences between Neosartorya and other Aspergillus species

These approaches can provide a holistic view of how mcr1 functions within the broader context of fungal physiology, potentially revealing unexpected connections to pathogenicity, stress responses, or developmental processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.