Recombinant Neosartorya fumigata Palmitoyltransferase erf2 (erf2)

Shipped with Ice Packs
In Stock

Description

Core Properties

ParameterDetailSource
Gene IDAFUA_3G06470 (UniProt: Q4WWN2)
FunctionPalmitoyltransferase activity; modifies proteins via palmitate addition
Domain ArchitectureDHHC motif (cysteine-rich domain) critical for enzymatic activity
Full-Length Sequence607 amino acids (1–607 aa)

Production and Purification

  • Purification: His-tagged variants are purified via nickel or cobalt affinity chromatography .

  • Stability: Repeated freeze-thaw cycles degrade activity; aliquoting is recommended .

Functional Roles

Application AreaPotential Use CaseEvidence Base
Fungal PathogenesisStudying lipid modification in N. fumigata virulence factorsInferred from DHHC domain
Protein EngineeringModifying membrane proteins for biotechnological applicationsRecombinant production
Diagnostic BiomarkersExploring cross-reactivity with Aspergillus allergens (e.g., Asp f1/f2)Indirect (see )

Note: While erf2 shares structural homology with Aspergillus fumigatus allergens (e.g., AFMP2), no direct immunological cross-reactivity has been reported .

Comparative Analysis with Related Proteins

ProteinOrganismFunctionKey Differences from erf2
AFMP2A. fumigatusSecreted mannoproteinSerine/threonine-rich O-glycosylation sites absent in erf2
DHHC9Homo sapiensPalmitoyltransferaseHost specificity; lacks fungal motifs
Asp f2A. fumigatusMajor allergenNo enzymatic activity; immunogenic epitopes

Future Directions

While erf2’s role in N. fumigata pathogenesis remains underexplored, its recombinant availability enables:

  1. Functional Studies: Investigating substrate specificity and interactions with fungal membrane proteins.

  2. Therapeutic Targeting: Exploring inhibitors to block palmitoylation in fungal infections.

  3. Diagnostic Development: Assessing cross-reactivity with Aspergillus allergens (e.g., Asp f1/f2) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have a specific format requirement, please indicate it in your order notes. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. For dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you have a preferred tag type, please communicate it to us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
erf2; AFUA_3G06470; Palmitoyltransferase erf2; DHHC cysteine-rich domain-containing protein erf2; Ras protein acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-607
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
erf2
Target Protein Sequence
MSSAPETSDADHVSTAQPALGIPRPPSVGGISSRMTDVASEDGEQSQANTGISSRPPQSQ RSLSRRGPPPARSSITAHSQMTSRPGSSASRLSRSHIPSLTAQGFFRPMSSQRLQAHRGR PVTKETATPSEDWNDQLDQNRQSIISNGTFPQSSAPQEEAPPSRGTEFTDPIIPDRNTSN ASPFGNTTSRSVGESAKLLHDRDRVYKITPQHLDLGANHNIEKSDPSQRSPLSFLSLQNG NTAPEPRDNRAHERLSSADSSPGSIQKQHHAPTSANLGKNYEYFTGNTLFFGGGRFQNSR DKPINIATGIFVVLPSALFFAYSAPWLWHHISPAVPILFAYLFYICFSSFIHASVVDPGI IPRNLHPMPPPEPSGDPLLIGPPTNDWVMVKLATSDVAAMDVPVKYCKTCNIWRPPRCYH CRVCDNCVETLDHHCVWLNNCVGRRNYRYFFAFVSSATLLALFLLGASLAHVLVYRAREG VSFGSAIDKWRVPWAMVIYGALAAPYPASLWAYHLFLIGRGETTREYLNSHKFAKADRHR PFTQGNIFRNWISVLARPRPPTYLQFKRPYQEGDQRLSAMKRKDRPRDVEAQADIEMQHV PPTPRQG
Uniprot No.

Target Background

Function
Palmitoyltransferase specific for Ras proteins.
Database Links
Protein Families
DHHC palmitoyltransferase family, ERF2/ZDHHC9 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Neosartorya fumigata Palmitoyltransferase erf2?

Neosartorya fumigata Palmitoyltransferase erf2 functions as a protein acyltransferase that catalyzes the post-translational modification of proteins through palmitoylation. Based on homologous proteins like Saccharomyces cerevisiae Erf2, this enzyme transfers palmitate groups from palmitoyl-CoA to specific cysteine residues on target proteins through a thioester linkage. The reaction proceeds via a two-step mechanism: first, autopalmitoylation of the enzyme creates a palmitoyl-enzyme intermediate, and second, the transfer of the palmitoyl moiety occurs to the protein substrate . This modification is critical for protein localization, stability, and function, potentially contributing to fungal virulence and stress responses.

What structural domains characterize the Neosartorya fumigata erf2 protein?

The most critical structural feature of erf2 is the highly conserved DHHC-CRD (Asp-His-His-Cys Cysteine-Rich Domain) motif, which constitutes the catalytic core of the enzyme. This domain is necessary and sufficient for autopalmitoylation activity and is located within a predicted cytoplasmic loop between transmembrane spanning domains . The protein likely contains multiple transmembrane domains similar to other DHHC-PATs, with both N- and C-terminal regions extending into the cytoplasm. While the DHHC-CRD domain alone can perform autopalmitoylation, both the N- and C-terminal regions are crucial for efficient palmitate transfer to substrate proteins .

What expression systems are optimal for producing recombinant N. fumigata erf2?

E. coli expression systems represent the most commonly utilized platform for recombinant production of fungal proteins, including PATs. Based on similar recombinant protein production strategies, an E. coli expression system with appropriate affinity tags (such as His-SUMO) would be recommended for N. fumigata erf2 . When designing expression constructs, consider:

  • Codon optimization for E. coli expression

  • Inclusion of an N-terminal tag rather than C-terminal (as C-terminal tags may reduce activity)

  • Potential co-expression with binding partners if required for stability

  • Expression temperature optimization (typically 16-25°C for membrane proteins)

For membrane proteins like erf2, expression in cell-free systems or eukaryotic hosts like Pichia pastoris may provide advantages for proper folding and activity.

What purification protocols maximize yield and activity of recombinant erf2?

Purification protocols should be designed to maintain the native conformation and activity of erf2. A recommended protocol would include:

  • Affinity chromatography using His-tag (preferably N-terminal)

  • Buffer optimization containing detergents suitable for membrane proteins

  • Size exclusion chromatography for final polishing

StepComponentRecommended ConditionRationale
Cell LysisBuffer compositionTris/PBS-based buffer with protease inhibitorsMaintains protein stability
SolubilizationDetergentMild non-ionic detergents (DDM, LMNG)Preserves membrane protein structure
Affinity PurificationColumnNi-NTA for His-tagged proteinsHigh specificity capture
StorageBufferTris/PBS with 5-50% glycerolPrevents aggregation and degradation

Quality assessment should include SDS-PAGE analysis to ensure purity greater than 90%, similar to other recombinant fungal proteins .

How should storage conditions be optimized to maintain erf2 activity?

To maintain the activity and stability of purified recombinant erf2, implement the following storage guidelines:

  • Store at -20°C/-80°C immediately upon receipt

  • Aliquot the protein to avoid repeated freeze-thaw cycles

  • Add glycerol to a final concentration of 5-50% as a cryoprotectant

  • For short-term use, store working aliquots at 4°C for up to one week

Protein in liquid form typically remains stable for up to 6 months at -20°C/-80°C, while lyophilized protein preparations may maintain stability for up to 12 months . Considering the membrane-associated nature of erf2, additional stabilizing agents such as specific lipids or detergents may be beneficial.

What are the recommended enzymatic assays for measuring erf2 palmitoyltransferase activity?

Several complementary approaches can be employed to assess the palmitoyltransferase activity of recombinant erf2:

  • Coupled enzyme assay: Monitors the turnover of palmitoyl-enzyme species indirectly by measuring the rate of CoASH release using a secondary detection system . This provides real-time kinetic data.

  • Radiolabeled assay: Utilizes [³H]palmitoyl-CoA to track the incorporation of radiolabeled palmitate into both the enzyme during autopalmitoylation and the substrate during transfer. This approach allows direct visualization of palmitate incorporation via SDS-PAGE followed by fluorography .

  • Click chemistry-based assays: Employs alkyne- or azide-modified palmitate analogs that can be conjugated to fluorescent reporters after the palmitoylation reaction, providing a non-radioactive alternative.

Each assay should include appropriate controls to distinguish enzymatic activity from non-specific interactions or spontaneous palmitoylation.

How can researchers identify and validate substrate proteins for N. fumigata erf2?

Substrate identification for erf2 requires a multi-faceted approach:

  • Bioinformatic prediction: Analyze N. fumigata proteins for potential palmitoylation sites and compare with known substrates of homologous PATs from model organisms.

  • In vitro palmitoylation assays: Test candidate substrates using purified recombinant erf2 and [³H]palmitoyl-CoA, monitoring palmitate incorporation similar to the Ras2 palmitoylation assays performed with yeast Erf2 .

  • Proteomic approaches: Implement acyl-biotin exchange (ABE) or acyl-resin-assisted capture (acyl-RAC) methods to identify palmitoylated proteins from N. fumigata, followed by comparative analysis between wild-type and erf2-deficient strains.

  • Validation studies: Confirm direct palmitoylation by erf2 through site-directed mutagenesis of predicted palmitoylation sites on candidate substrates and demonstrating reduced modification.

Focus on proteins involved in virulence, stress response, and cell wall integrity pathways as high-priority candidates based on known functions of palmitoylated proteins in other fungi.

What kinetic parameters should be determined to characterize erf2 enzymatic activity?

A comprehensive kinetic characterization of erf2 should include:

ParameterDetermination MethodSignificance
kcatSteady-state activity measurementsCatalytic efficiency
Km for palmitoyl-CoAVarying palmitoyl-CoA concentrationsSubstrate affinity
Km for protein substratesVarying protein substrate concentrationsSubstrate recognition
Rate of autopalmitoylationTime-course of enzyme palmitoylationFirst reaction step efficiency
Rate of palmitoyl transferTime-course of substrate palmitoylationSecond reaction step efficiency
Palmitoyl-enzyme hydrolysis rateStability of the palmitoyl-enzyme intermediateCatalytic cycle control point

Determine these parameters under varying conditions (pH, temperature, ionic strength) to establish the optimal enzymatic environment and provide insights into the catalytic mechanism .

Which amino acid residues are critical for erf2 catalytic activity?

Based on mutational studies of homologous DHHC-PATs, the following residues are likely critical for erf2 function:

  • Cysteine in DHHC motif: The cysteine residue (equivalent to C203 in S. cerevisiae Erf2) is absolutely essential for autopalmitoylation and subsequent transfer activity. Mutation of this residue to serine (C203S) completely abolishes enzymatic activity .

  • Histidine residues in DHHC motif: Particularly the second histidine (equivalent to H201 in yeast), which when mutated to alanine (H201A) shows delayed autopalmitoylation and reduced palmitoyl-enzyme thioester hydrolysis, inhibiting the turnover of the palmitoyl-enzyme intermediate .

  • Conserved residues surrounding DHHC: Including R185 and F218 (in yeast), which when mutated affect the kinetics of autopalmitoylation and steady-state levels of palmitoyl-enzyme intermediate .

  • Auxiliary cysteine residues: Such as C209 in yeast Erf2, which influences the stability of the palmitoyl-enzyme intermediate but is not absolutely required for catalysis .

These structure-function insights can guide targeted mutations in N. fumigata erf2 to characterize its specific catalytic mechanism.

How does the DHHC-CRD domain contribute to the autopalmitoylation mechanism?

The DHHC-CRD domain constitutes the catalytic core of the enzyme and is both necessary and sufficient for autopalmitoylation activity . This domain functions as follows:

  • The cysteine within the DHHC motif forms a thioester linkage with the palmitoyl group from palmitoyl-CoA during autopalmitoylation

  • The histidine residues likely participate in deprotonation of the cysteine, enhancing its nucleophilicity

  • Other conserved residues within the CRD create the appropriate chemical environment for catalysis

Mutation studies demonstrate that while the DHHC-CRD domain alone can perform autopalmitoylation, both N- and C-terminal regions of the full protein are required for efficient transfer of the palmitoyl group to substrate proteins . This suggests these regions play crucial roles in substrate recognition and positioning.

What structural approaches are most suitable for elucidating erf2 structure-function relationships?

Due to the membrane-associated nature of erf2, specialized structural biology approaches are recommended:

  • Cryo-electron microscopy (cryo-EM): Particularly suitable for membrane proteins, potentially revealing the arrangement of transmembrane domains and the position of the DHHC-CRD domain

  • X-ray crystallography of soluble domains: Crystallization of the isolated DHHC-CRD domain may be more tractable than the full-length protein

  • NMR studies of peptide interactions: To characterize substrate binding sites and conformational changes during catalysis

  • Molecular dynamics simulations: To model the enzyme mechanism and substrate interactions based on homology models from related PATs

  • Cross-linking mass spectrometry: To map domain interactions and conformational changes during the catalytic cycle

These structural data, combined with the functional insights from mutagenesis, would provide a comprehensive understanding of the erf2 catalytic mechanism.

How does erf2 activity contribute to Neosartorya fumigata virulence?

Palmitoyltransferase activity likely contributes to N. fumigata virulence through multiple mechanisms:

  • Modification of virulence factors: Key virulence proteins may require palmitoylation for proper localization or function, similar to how peroxiredoxins like Asp F3 contribute to virulence through detoxifying peroxides and sensing hydrogen peroxide-mediated signaling events .

  • Stress response regulation: Palmitoylation may regulate proteins involved in oxidative stress response, which is crucial for fungal survival during host immune attack.

  • Cell wall integrity maintenance: Proteins involved in cell wall synthesis and remodeling are common targets of palmitoylation in fungi, affecting host-pathogen interactions.

  • Signaling pathway modulation: Palmitoylation regulates the localization and activity of signaling proteins, potentially including those that control morphogenetic transitions important for infection.

Research approaches to investigate these connections include: creating erf2 knockout or catalytically inactive mutants in N. fumigata, assessing virulence in infection models, and identifying palmitoylated proteins that show altered modification patterns in erf2 mutants.

What are the methodological challenges in studying erf2 substrate specificity?

Investigating erf2 substrate specificity presents several methodological challenges:

  • Membrane protein reconstitution: Establishing conditions that maintain both erf2 and potential membrane-associated substrates in native-like environments for in vitro assays

  • Distinguishing direct from indirect effects: Determining whether altered palmitoylation in vivo is directly due to erf2 activity or results from downstream effects

  • Substrate competition: Developing assays that can differentiate relative affinities among multiple substrates

  • Temporal dynamics: Capturing the potentially transient nature of enzyme-substrate interactions

  • Post-translational regulation: Accounting for how other modifications may influence substrate recognition

To address these challenges, researchers should implement integrated approaches combining in vitro biochemical assays with cellular studies and proteomic analyses, carefully controlling for indirect effects through appropriate experimental designs.

How can erf2 be targeted for development of novel antifungal strategies?

The essential role of protein palmitoylation in fungal physiology makes erf2 a promising target for antifungal development:

  • High-throughput screening: Design assays using purified recombinant erf2 to screen for small molecule inhibitors that specifically block autopalmitoylation or transfer activity

  • Structure-based drug design: Utilize structural insights about the catalytic mechanism to design compounds that competitively inhibit palmitoyl-CoA binding or irreversibly modify the active site cysteine

  • Substrate-competitive inhibitors: Develop peptide-based inhibitors mimicking the recognition sequences of key substrates

  • Selective targeting: Exploit structural differences between fungal and human DHHC proteins to achieve selectivity

  • Combination approaches: Test erf2 inhibitors in combination with existing antifungals to identify synergistic effects

Research should focus on establishing the essentiality of erf2 for fungal viability and validating the predicted reduced virulence of erf2 mutants in infection models before investing heavily in inhibitor development.

What are common technical issues in recombinant erf2 expression and activity assays?

Researchers commonly encounter these technical challenges when working with erf2:

  • Low expression yields: As a membrane protein, erf2 often expresses poorly in recombinant systems. Optimize by testing different expression temperatures, induction conditions, and host strains.

  • Protein aggregation: Membrane proteins tend to aggregate during purification. Use appropriate detergents and consider adding lipids that mimic the native membrane environment.

  • Loss of activity during purification: Activity can be compromised by detergent choice or removal of essential cofactors. Perform activity assays at multiple purification stages to identify problematic steps.

  • Inconsistent autopalmitoylation: The palmitoyl-enzyme intermediate may undergo hydrolysis and re-palmitoylation cycles, causing variability in assays . Standardize reaction conditions and time points for measurement.

  • Background palmitoylation: Non-enzymatic palmitoylation can occur at high palmitoyl-CoA concentrations. Include proper controls with catalytically inactive enzyme mutants (C203S equivalent).

  • Detection sensitivity: Some assays may lack sensitivity for detecting low levels of palmitoylation. Consider using multiple complementary detection methods.

What controls are essential when characterizing recombinant erf2 activity?

Rigorous controls are critical for reliable interpretation of erf2 activity assays:

Control TypeImplementationPurpose
Negative enzyme controlHeat-inactivated enzymeConfirm activity is enzymatic
Catalytic mutantC203S equivalent mutationDistinguish specific from non-specific activities
Substrate specificityNon-substrate proteinsValidate substrate selectivity
Time zeroSamples processed immediatelyEstablish baseline measurements
Palmitate competitionUnlabeled palmitoyl-CoAConfirm specificity of labeling
Reducing agent sensitivityDTT treatment post-reactionVerify thioester linkage formation
Hydroxylamine sensitivityNH₂OH treatment post-reactionConfirm thioester bond specificity

Additionally, when expressing mutant versions of erf2, verify proper expression and folding through techniques such as circular dichroism or limited proteolysis to ensure that activity differences are not due to structural perturbations .

How can researchers distinguish between direct and indirect effects of erf2 inhibition in cellular studies?

To differentiate direct from indirect effects of erf2 inhibition:

  • Use catalytically inactive mutants: Compare phenotypes between knockout and catalytically inactive mutants (e.g., DHHC to DHHS) to distinguish scaffolding from enzymatic functions

  • Implement rescue experiments: Attempt to rescue phenotypes with wild-type erf2 expression or by directly introducing palmitoylated forms of suspected substrate proteins

  • Employ chemical-genetic approaches: Use inhibitor-resistant erf2 mutants to confirm on-target effects of small molecule inhibitors

  • Utilize time-course studies: Track the temporal sequence of events following acute erf2 inhibition to identify primary versus secondary effects

  • Perform substrate-specific assays: Directly measure palmitoylation status of suspected substrates using techniques like acyl-biotin exchange or metabolic labeling

  • Conduct domain complementation: Test whether specific domains of erf2 can rescue particular aspects of the phenotype to map structure-function relationships

These approaches collectively provide stronger evidence for causal relationships between erf2 activity and observed phenotypes than correlative observations alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.