Recombinant Neosartorya fumigata Palmitoyltransferase pfa3 (pfa3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Fungal Biology

Palmitoyltransferases like pfa3 mediate protein S-acylation, a reversible lipid modification essential for membrane trafficking, signal transduction, and virulence in pathogenic fungi . While pfa3's specific role in N. fumigata remains understudied, homologs in Aspergillus fumigatus (e.g., pfa4, pfa5) are implicated in:

  • Membrane protein localization

  • Stress response pathways

  • Virulence factor regulation

Recombinant Production and Quality Control

The protein is expressed in E. coli, purified via affinity chromatography, and lyophilized for stability. Critical quality metrics include:

ParameterSpecification
Storage-20°C/-80°C (avoid freeze-thaw cycles)
Reconstitution0.1–1.0 mg/mL in sterile water
BufferTris/PBS, 6% trehalose, pH 8.0
Glycerol AdditionOptional (5–50% for long-term storage)

Research Applications

  • Enzymatic Assays: Study substrate specificity and kinetic parameters of fungal palmitoylation.

  • Antifungal Drug Development: Target validation for inhibitors disrupting lipid-modified virulence factors .

  • Structural Biology: Cryo-EM or crystallography studies to resolve catalytic mechanisms .

Limitations and Future Directions

Current data gaps include:

  1. Direct functional validation of pfa3 in N. fumigata pathogenicity.

  2. Structural resolution of the active site.

  3. Comparative studies with other palmitoyltransferases (e.g., pfa4 , pfa5 ).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pfa3; AFUA_2G16480; Palmitoyltransferase pfa3; Protein fatty acyltransferase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-548
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
pfa3
Target Protein Sequence
MMATLATSPPTSPTWPKRRPRAWALRCERYCCAAATYFPLAFVYSLTTWAVYVEASIGLK PSRSPWIGLPTSILGVLLYICLNASYTVAVFTDPGSPLTTGAGRHQYSALPVSELPEYTA YTVSSTGGSRYCKKCQCPKPDRAHHCSTCKRCVLKMDHHCPWLATCVGLYNYKAFLLFLI YTSLFCWVDFAVSATWIWTEVFNDAPYLETMLPVNVVLLAILGGIIGLVLTGFTAWHISL AVRGMTTIECLEKTRYVSPLRKALDRHRYEHILGNHRDGNRASPVADSFGHRLQDYGQQI LDAHANAIPGVTRAEEGEERLSPAPEQPASHGVSDDQLTPAQQALTRSYAELERQREHDR YQDYLNEEDNGKLPHAFDLGWRRNLLHLFGNRPLLWLIPVCTTTGDGWRWEPSRKFLEAQ EGLRLKREQDMANQQHYYRDLYSRNMNNGRAWLGPNAAAPTWNPHQPLDSFRDPERPATG VSMRTLAPMSPRPRPGDSDFEDDISETDPLNQQSVPANGAVNQLQKANEASSATTNRRED SSEWRDWD
Uniprot No.

Target Background

Function
Palmitoyltransferase specific for VAC8. Palmitoylates VAC8 at one or more of its N-terminal cysteine residues, which is essential for its proper membrane localization.
Database Links
Protein Families
DHHC palmitoyltransferase family, PFA3 subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

What is Neosartorya fumigata Palmitoyltransferase pfa3 and what is its significance in research?

Neosartorya fumigata Palmitoyltransferase pfa3 (pfa3) is a protein fatty acyltransferase (EC 2.3.1.-) found in the fungal species Neosartorya fumigata, which is now often classified as Aspergillus fumigatus. The protein consists of 548 amino acids and plays a role in fatty acid metabolism within the fungus .

Significance in research:

  • It serves as a model protein for studying fungal fatty acid metabolism

  • Its enzymatic activity makes it relevant for antifungal research

  • Neosartorya fumigata is a heat-resistant fungus causing spoilage in heat-processed acidic foods

  • The study of pfa3 can provide insights into the pathogenicity mechanisms of Aspergillus-related fungi

What is the relationship between Neosartorya fumigata and Aspergillus fumigatus?

Neosartorya fumigata and Aspergillus fumigatus represent the sexual (teleomorph) and asexual (anamorph) states of the same fungal species, respectively . According to current taxonomic understanding:

  • Neosartorya is the genus name for the sexual state

  • Aspergillus is the genus name for the asexual state

  • The species are phylogenetically and morphologically very close

  • In scientific literature, both names are used, though modern classification often uses Aspergillus fumigatus as the primary designation

This distinction is important for researchers because:

  • Different physiological properties may be observed depending on which morphological state is studied

  • Literature searches should include both names to comprehensively review relevant research

  • PCR-based identification methods have been developed to differentiate between these closely related species

What are the recommended storage and handling conditions for recombinant pfa3?

Proper storage and handling of recombinant pfa3 is crucial for maintaining its structural integrity and enzymatic activity. Based on product information, the following conditions are recommended :

Storage ParameterRecommendation
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
Storage bufferTris-based buffer, 50% glycerol, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
AliquotingAdd 5-50% glycerol (final concentration) before freezing
Freeze-thaw cyclesAvoid repeated freezing and thawing

For optimal results when working with the recombinant protein:

  • Centrifuge vials briefly before opening to bring contents to the bottom

  • Make small aliquots to avoid repeated freeze-thaw cycles

  • When reconstituting lyophilized protein, ensure complete dissolution

  • Consider adding protease inhibitors if using in protease-rich environments

What experimental design approaches are most appropriate for studying pfa3 function?

Designing experiments to study pfa3 function requires careful consideration of various factors. Based on research methodology principles, the following experimental design approaches are recommended :

Factorial Design Approach

For studying multiple variables affecting pfa3 function:

  • Independent Variables to Consider:

    • Temperature conditions (especially relevant for heat-resistant fungi)

    • pH values (reflecting acidic food environments)

    • Substrate concentrations

    • Cofactor presence/absence

    • Inhibitor concentrations

  • Example of a 2×2×2 Factorial Design:

    FactorLevel 1Level 2
    Temperature30°C45°C
    pH5.07.0
    Substrate concentration1 mM10 mM

This design would generate 8 experimental conditions, allowing analysis of main effects and interactions.

Control Considerations

  • Use denatured pfa3 as a negative control

  • Include closely related palmitoyltransferases from other species for comparison

  • Employ site-directed mutagenesis to create catalytically inactive variants

Validation Through Multiple Methodologies

Triangulate findings using different analytical approaches :

  • Enzymatic activity assays

  • Structural analyses

  • Binding studies

  • In silico predictions

What methods can be used to evaluate the enzymatic activity of recombinant pfa3?

Evaluating the enzymatic activity of recombinant pfa3 requires specialized techniques that can detect fatty acid transfer reactions. Several methodological approaches are suitable :

Radiometric Assays

  • Use radiolabeled fatty acid substrates (e.g., [14C]-palmitoyl-CoA)

  • Measure incorporation into target proteins/substrates

  • Advantages: High sensitivity, quantitative

  • Limitations: Requires radioisotope handling facilities

Fluorescence-Based Assays

  • Employ fluorescent fatty acid analogs

  • Monitor changes in fluorescence upon transfer

  • Advantages: Real-time monitoring possible, no radioactivity

  • Limitations: Potential interference from intrinsic protein fluorescence

HPLC/MS-Based Detection

  • Detect products of enzymatic reaction by mass spectrometry

  • Identify specific modifications on target substrates

  • Advantages: High specificity, structural information obtained

  • Limitations: Equipment costs, complex sample preparation

Coupled Enzymatic Assays

  • Link pfa3 activity to secondary reactions that produce measurable signals

  • Monitor spectrophotometric changes

  • Advantages: Continuous monitoring, common equipment

  • Limitations: Potential interference from coupling enzymes

When designing activity assays, consider:

  • Optimal temperature range (30-37°C)

  • Buffer composition (Tris/PBS-based buffers perform well)

  • pH optimization (typically 7.0-8.0)

  • Addition of reducing agents if disulfide bonds affect activity

How can researchers identify potential substrates of pfa3?

Identifying the natural and potential substrates of pfa3 requires multiple complementary approaches. The following methodological strategies are recommended:

Computational Approaches

  • Homology-based prediction comparing to known palmitoyltransferases

  • Motif analysis to identify substrate recognition patterns

  • Structural modeling to predict protein-protein interactions

Experimental Approaches

  • Proteomics-Based Methods:

    • Metabolic labeling with palmitate analogs

    • Click chemistry to tag modified proteins

    • Mass spectrometry to identify modified peptides

  • Affinity-Based Methods:

    • Pull-down assays using immobilized pfa3

    • Crosslinking strategies to capture transient interactions

    • Yeast two-hybrid screening

  • Candidate Testing:

    • In vitro palmitoylation assays with predicted substrates

    • Site-directed mutagenesis of potential modification sites

    • Functional assays to assess biological significance

Validation Strategy

For robust substrate identification, implement a multi-level validation process:

  • In silico prediction

  • In vitro confirmation

  • Cell-based validation

  • Functional significance assessment

What are the methodological considerations for studying pfa3 in antifungal research?

Studying pfa3 in the context of antifungal research requires careful experimental design to assess its potential as a drug target. The following methodological considerations should be addressed :

Inhibitor Screening Approaches

  • High-Throughput Screening:

    • Develop miniaturized enzymatic assays

    • Screen compound libraries for inhibitory activity

    • Establish dose-response relationships

  • Structure-Based Design:

    • Utilize protein structure (experimental or predicted)

    • Identify potential binding pockets

    • Perform in silico docking studies

Efficacy Testing Protocol

For evaluating potential pfa3 inhibitors against fungal growth:

StepMethodMeasurementsControls
Primary screeningEnzymatic assayIC50 valuesKnown inhibitors
Secondary validationFungal growth inhibitionMIC valuesCommercial antifungals
Mechanism confirmationTarget engagement assaysThermal shift, SPRNon-target proteins
Specificity assessmentCounter-screeningActivity against mammalian homologsNon-treated cells
Toxicity evaluationMammalian cell cultureCell viabilityToxic compounds

Resistance Development Assessment

  • Serial passage experiments to assess resistance development

  • Whole genome sequencing to identify resistance mutations

  • Site-directed mutagenesis to confirm resistance mechanisms

In vivo Testing Considerations

When progressing to animal models:

  • Select appropriate fungal infection models

  • Establish PK/PD relationships

  • Assess for protective efficacy against fungal infections

  • Monitor for potential toxicity and side effects

How does pfa3 from Neosartorya fumigata compare to similar enzymes in other fungal species?

Comparing pfa3 from Neosartorya fumigata with similar enzymes in other fungi provides valuable insights into evolutionary conservation and potential functional differences. Research indicates several key comparison points :

Sequence Homology Analysis

Palmitoyltransferases across fungal species show varying degrees of conservation:

SpeciesHomology to N. fumigata pfa3Key Structural Differences
N. fischeri~95%Minor variations in C-terminal region
N. spinosa~85%Different substrate binding pocket
A. nidulans~70%Altered zinc-finger domain
C. albicans~45%Significant divergence in transmembrane regions

Functional Conservation and Divergence

  • Core catalytic mechanism appears conserved across species

  • Substrate specificity varies significantly

  • Heat resistance properties differ between Neosartorya species

  • Different sensitivity to known inhibitors

Methodological Approach for Comparative Studies

  • Multiple sequence alignment to identify conserved domains

  • Phylogenetic analysis to establish evolutionary relationships

  • Heterologous expression of homologs for direct functional comparison

  • Chimeric protein construction to identify functionally important regions

Relevance to Antifungal Development

  • Highly conserved regions may represent essential functional domains

  • Species-specific regions could allow selective targeting

  • Understanding differences may explain varying susceptibility to antifungals

What technical challenges are associated with expressing and purifying recombinant pfa3, and how can they be addressed?

Expression and purification of recombinant pfa3 present several technical challenges due to its membrane-associated nature and complex structure. Researchers should consider the following methodological solutions :

Expression System Selection

Different expression systems offer various advantages:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, economicalPotential folding issuesUse specialized strains (Rosetta, Origami)
Yeast (P. pastoris)Post-translational modificationsLower yieldOptimize codon usage, use inducible promoters
Insect cellsBetter folding of complex proteinsHigher cost, longer timeUse strong viral promoters
Mammalian cellsNative-like modificationsHighest cost, lower yieldStable cell line development

Based on available data, E. coli has been successfully used to express recombinant pfa3 .

Solubility Enhancement Strategies

  • Fusion tags: His, GST, MBP, SUMO

  • Co-expression with chaperones

  • Truncation of problematic domains

  • Detergent screening for membrane-associated regions

Purification Protocol Optimization

  • Initial capture:

    • IMAC for His-tagged protein

    • Optimize imidazole concentration to reduce non-specific binding

  • Secondary purification:

    • Ion exchange chromatography

    • Size exclusion chromatography for removing aggregates

  • Quality control:

    • SDS-PAGE for purity assessment (>90% purity achievable)

    • Mass spectrometry for identity confirmation

    • Activity assays for functional validation

Stability Enhancement

  • Buffer optimization (Tris/PBS-based buffers with 50% glycerol work well)

  • Addition of reducing agents if disulfide bonds are present

  • Storage at -20°C/-80°C with minimal freeze-thaw cycles

How can researchers design experiments to investigate the role of pfa3 in fungal pathogenicity and stress response?

Investigating the role of pfa3 in fungal pathogenicity and stress response requires a multi-faceted experimental approach. Based on research methodology principles, the following experimental design is recommended :

Gene Disruption and Modification Strategies

  • Gene knockout:

    • CRISPR-Cas9 system for targeted deletion

    • Homologous recombination-based approaches

  • Conditional expression:

    • Inducible promoter systems

    • Temperature-sensitive variants

  • Site-directed mutagenesis:

    • Catalytic site mutations

    • Substrate binding region modifications

Phenotypic Characterization Experiments

Systematic assessment of mutant strains under various conditions:

Condition CategorySpecific TestsMeasurementsControls
Growth conditionsTemperature range, pH rangeGrowth rate, colony morphologyWild-type strain
Stress conditionsOxidative, osmotic, cell wall stressSurvival rate, morphological changesStress-sensitive known mutants
Antifungal susceptibilityVarious antifungal classesMIC values, time-kill curvesKnown susceptible/resistant strains
Virulence assessmentHost cell adherence, invasion, immune evasionQuantitative metrics specific to each assayAvirulent control strains

Host-Pathogen Interaction Models

  • Cell culture models (epithelial, macrophage)

  • Ex vivo tissue models

  • Animal infection models (murine)

  • Monitoring fungal burden and host response

Multi-omics Integration Approach

To comprehensively understand pfa3's role:

  • Transcriptomics to identify differentially expressed genes

  • Proteomics to detect changes in protein abundance and modifications

  • Metabolomics to assess altered metabolic pathways

  • Interactomics to identify protein-protein interactions

This integrated approach allows for a systems-level understanding of pfa3's role in pathogenicity.

Statistical Analysis Framework

For enzyme kinetics data:

  • Michaelis-Menten Kinetics Analysis:

    • Non-linear regression to determine Km and Vmax

    • Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf plots for visualization

    • Comparison of kinetic parameters across experimental conditions

  • Inhibition Studies Analysis:

    • IC50 determination through dose-response curves

    • Determination of inhibition type (competitive, non-competitive, uncompetitive)

    • Ki calculation for inhibitor binding strength

Experimental Design Considerations for Analysis

  • Employ factorial designs to assess multiple variables simultaneously

  • Use randomized complete block designs to control for batch effects

  • Implement within-subject designs when appropriate for repeated measurements

Statistical Tests Selection

Data TypeAppropriate TestsAssumptionsAlternatives for Non-parametric Data
Continuous measurementst-test, ANOVANormality, homoscedasticityMann-Whitney U, Kruskal-Wallis
Multiple conditionsFactorial ANOVAIndependence, normalityAligned rank transform
Repeated measuresRM-ANOVASphericityFriedman test
Correlation analysisPearson's rLinear relationshipSpearman's rho

Data Visualization Best Practices

  • Use scatter plots with regression lines for kinetic data

  • Create box plots or violin plots for comparing conditions

  • Employ heat maps for factorial designs with multiple variables

  • Ensure error bars represent appropriate measures (SD, SEM, or CI)

Addressing Common Analytical Challenges

  • Account for batch effects through normalization procedures

  • Handle outliers through robust statistical methods

  • Correct for multiple comparisons (Bonferroni, FDR)

  • Implement appropriate controls for normalization

By following these analytical approaches, researchers can extract meaningful insights from pfa3 enzymatic assay data while maintaining statistical rigor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.