Recombinant Neosartorya fumigata Palmitoyltransferase pfa5 (pfa5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your requests to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
pfa5; AFUA_5G08740; Palmitoyltransferase pfa5; Protein fatty acyltransferase 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
pfa5
Target Protein Sequence
MARRAADKRVNLAVSRIIPPILIGVFGYASYAITKPLCVDYLIHPAHHYDRRSRSGAGAA ILAIYYVLLIPVLATYLRLLYNVVLSPGYLPRGTACTQNQTGSDGSKHRHRRHRRRKSGH HLSKTTEKTDRSDGGDVERGLEYSARAKAYPLDAEGLESFYTKDVFVCQPDGRPVYCSTC CQFKTDRAHHCREVDRCVRKMDHFCPWVGGVVSETSFKFFIQFIVYTMIYCIFVLIVFAI YTAELRREAGRTNVHWIVCLALSSLFGFFTFGVAISSVQLAANNLTTIENLNRRSAVWTL AIRVPRHILSKRWAPTFRTITYPLPPVPPAESEVARESPGGEQHVFAILQTLPGENPFDL GSPLKNIQQVMGFSLLEWLLPIKQSPCADHSSNESAFALGPVVTRLKKEAGLEVSTESES ADPVGAAETPQHEQRRGKHRRRN
Uniprot No.

Target Background

Database Links
Protein Families
DHHC palmitoyltransferase family, PFA5 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Neosartorya fumigata Palmitoyltransferase pfa5 and what is its function?

Palmitoyltransferase pfa5 (Protein fatty acyltransferase 5) is an enzyme encoded by the pfa5 gene (AFUA_5G08740) in Neosartorya fumigata (Aspergillus fumigatus). It belongs to enzyme class EC 2.3.1.-, which catalyzes the transfer of acyl groups to substrates . Specifically, palmitoyltransferases attach palmitate (a 16-carbon fatty acid) to proteins, affecting protein localization, stability, and function. In pathogenic fungi, protein palmitoylation plays crucial roles in growth, morphogenesis, and virulence mechanisms.

Palmitoyltransferases typically contain conserved DHHC (Asp-His-His-Cys) cysteine-rich domains critical for catalytic activity. While specific substrates of pfa5 in A. fumigatus are still being characterized, the enzyme likely contributes to cellular processes involved in fungal pathogenicity.

What is the taxonomic relationship between Neosartorya fumigata and Aspergillus fumigatus?

Neosartorya fumigata and Aspergillus fumigatus refer to the same organism at different stages of its life cycle. Neosartorya fumigata is the teleomorph (sexual form) name, while Aspergillus fumigatus is the anamorph (asexual form) . Current taxonomic conventions generally prefer using a single name, with Aspergillus fumigatus being more commonly used in clinical and research settings.

The species belongs to Aspergillus section Fumigati, which includes several closely related species . This taxonomic complexity has practical implications for research, as misidentification can occur when using only morphological criteria . For precise species identification, molecular methods analyzing internal transcribed spacer (ITS) regions, β-tubulin, calmodulin, and actin genes are recommended .

What are the optimal storage and handling conditions for recombinant pfa5 protein?

Based on product specifications for commercially available recombinant pfa5:

ParameterRecommended Condition
Short-term storage4°C (up to one week)
Long-term storage-20°C or -80°C
Buffer compositionTris-based buffer with 50% glycerol
Important precautionsAvoid repeated freeze-thaw cycles

The protein should be stored in a Tris-based buffer with 50% glycerol, which helps maintain stability during freezing . It is strongly recommended to make small aliquots before freezing to minimize freeze-thaw cycles, as repeated freezing and thawing can lead to protein denaturation and loss of enzymatic activity . This practice is particularly important for enzymes like palmitoyltransferases, where structural integrity is essential for function.

What expression systems and purification strategies are recommended for producing functional recombinant pfa5?

The selection of an appropriate expression system depends on the research objectives:

Expression SystemAdvantagesLimitationsBest For
E. coliFast growth, high yield, economicalMay lack proper PTMs, inclusion body formationInitial characterization, antibody production
Yeast (P. pastoris, S. cerevisiae)Eukaryotic PTMs, secretion possibleLonger production timeFunctional studies requiring proper folding
Insect cells (Sf9, Hi5)Complex eukaryotic PTMsMore expensive, technically demandingStructural studies, enzyme activity assays
Mammalian cellsMost authentic PTMsHighest cost, lowest yieldStudies requiring native-like enzyme activity

For purification, affinity chromatography using His-tag, GST-tag, or SUMO-tag systems is commonly employed . The commercial recombinant pfa5 product uses a tag type determined during the production process . After initial affinity purification, additional steps like ion exchange chromatography or size exclusion chromatography are recommended to achieve higher purity.

Critically, researchers should validate that the recombinant protein maintains enzymatic activity, as improper folding or lack of essential post-translational modifications can affect functionality, particularly for membrane-associated enzymes like palmitoyltransferases.

How can researchers experimentally determine the substrate specificity of pfa5?

Determining substrate specificity for palmitoyltransferases requires a systematic approach:

  • In vitro palmitoylation assays: Using purified recombinant pfa5 with radiolabeled palmitoyl-CoA (e.g., [3H]-palmitoyl-CoA) or bio-orthogonal analogs like 17-octadecynoic acid (17-ODYA), followed by detection via autoradiography or click chemistry.

  • Proteome-wide substrate identification:

    • Acyl-biotin exchange (ABE): A three-step process involving: (a) blocking free thiols, (b) cleaving thioester bonds, and (c) biotinylating newly exposed thiols for purification and identification.

    • Metabolic labeling: Culturing cells with palmitate analogs to label palmitoylated proteins in vivo.

    • Comparative analysis of palmitoylated proteins in wild-type vs. Δpfa5 mutants using mass spectrometry.

  • Candidate approach: Testing specific proteins of interest in targeted assays, especially virulence factors or proteins involved in cell wall integrity.

  • Validation of direct pfa5-substrate relationships:

    • Site-directed mutagenesis of putative palmitoylation sites (cysteine residues)

    • Co-immunoprecipitation of pfa5 with candidate substrates

    • In vitro confirmation using purified proteins

The identification of pfa5 substrates would significantly advance our understanding of its role in fungal biology and potentially reveal new pathways involved in virulence and drug resistance.

What is the potential role of pfa5 in A. fumigatus pathogenicity and virulence?

While the specific contribution of pfa5 to A. fumigatus pathogenicity remains to be fully characterized, several hypotheses can be formulated based on known roles of protein palmitoylation in fungal virulence:

  • Cell wall integrity: Palmitoylation may modify proteins involved in cell wall biosynthesis or remodeling, affecting resistance to host defense mechanisms.

  • Stress response regulation: Palmitoyltransferases can modulate signaling pathways that respond to environmental stresses encountered during infection.

  • Hyphal morphogenesis: Protein palmitoylation could influence the transition between different growth forms, which is critical for tissue invasion.

  • Evasion of host immune responses: Modification of surface proteins may alter recognition by pattern recognition receptors.

  • Biofilm formation: Palmitoylated proteins may contribute to adhesion and formation of biofilms, which are associated with antifungal resistance .

Experimental approaches to investigate these hypotheses include:

  • Constructing pfa5 knockout or conditional mutants and assessing virulence in infection models

  • Comparative analysis of palmitoylated proteins during infection vs. in vitro growth

  • Testing pfa5 mutant susceptibility to host defense mechanisms and antifungal drugs

Notably, the role of pfa5 could be similar to that of other fungal palmitoyltransferases that have been implicated in virulence of pathogenic fungi like Cryptococcus neoformans and Candida albicans.

What methodologies are most effective for studying pfa5 enzymatic activity in vitro?

Effective methodologies for studying pfa5 enzymatic activity include:

  • Radioactive assays: Using [3H] or [14C]-labeled palmitoyl-CoA as a substrate, followed by thin-layer chromatography or SDS-PAGE/autoradiography.

  • Bio-orthogonal chemistry approaches:

    • Click chemistry using alkyne-modified fatty acids (17-ODYA)

    • Detection via copper-catalyzed azide-alkyne cycloaddition reaction

    • Visualization by in-gel fluorescence or affinity purification

  • FRET-based assays: Using fluorescently labeled substrate peptides where palmitoylation changes the fluorescence properties.

  • Mass spectrometry:

    • Direct detection of palmitoylated products

    • Quantification of palmitoyl-CoA consumption

    • Analysis of enzyme kinetics and substrate preference

  • Structural studies:

    • X-ray crystallography of pfa5 with substrate analogs

    • Cryo-EM analysis of the enzyme-substrate complex

    • Computational modeling of enzyme-substrate interactions

For optimal enzyme activity, ensure:

  • Appropriate buffer conditions (pH 7.0-8.0, typically)

  • Presence of reducing agents (DTT or β-mercaptoethanol)

  • Detergent concentrations that maintain enzyme solubility without inhibiting activity

  • Temperature control (typically 30-37°C for fungal enzymes)

  • Protection from oxidation during the reaction

How can pfa5 be targeted for antifungal drug development?

Targeting pfa5 for antifungal drug development represents a novel approach that could address the growing challenge of antifungal resistance in A. fumigatus . Several strategies include:

  • Direct enzyme inhibition:

    • High-throughput screening of chemical libraries against recombinant pfa5

    • Structure-based design of inhibitors targeting the catalytic DHHC domain

    • Development of palmitoyl-CoA analogs that competitively inhibit the enzyme

  • Target validation requirements:

    • Demonstration that pfa5 is essential for virulence in animal models

    • Confirmation that inhibiting pfa5 affects fungal viability or virulence

    • Assessment of potential off-target effects on human palmitoyltransferases

  • Combination therapy potential:

    • Testing synergistic effects with existing antifungals

    • Similar to the approach with Neosartorya (Aspergillus) fischeri antifungal proteins, where combinations showed synergistic effects

  • Selectivity considerations:

    • Comparative analysis of fungal vs. human palmitoyltransferases

    • Identification of structural differences that can be exploited for selective targeting

    • Focus on inhibiting palmitoylation of fungal-specific substrates

The development of pfa5 inhibitors would represent a new class of antifungals with a novel mechanism of action, potentially addressing the urgent need for new treatments against increasingly resistant Aspergillus infections.

What genetic manipulation approaches can be used to study pfa5 function in vivo?

To comprehensively investigate pfa5 function in vivo, several genetic manipulation strategies can be employed:

  • Gene deletion/knockout:

    • CRISPR-Cas9 mediated deletion of pfa5

    • Homologous recombination-based gene replacement

    • Analysis of resultant phenotypes in growth, morphology, stress response, and virulence

  • Conditional expression systems:

    • Tetracycline-regulated promoters for inducible expression

    • Nitrogen or carbon source-dependent promoters

    • Temperature-sensitive promoters for temporal control

  • Site-directed mutagenesis:

    • Mutation of catalytic cysteine residues to ablate enzymatic activity

    • Modification of substrate recognition domains

    • Creation of point mutations to study structure-function relationships

  • Fluorescent protein fusions:

    • C- or N-terminal GFP/RFP tagging for subcellular localization

    • Verification that fusion proteins retain enzymatic activity

    • Live-cell imaging to track dynamics during infection

  • Complementation studies:

    • Reintroduction of wild-type pfa5 into deletion mutants

    • Cross-species complementation with homologs from related fungi

    • Domain swapping experiments to identify functional regions

These approaches should be complemented with phenotypic analyses including growth rate determination, susceptibility to various stresses (oxidative, temperature, antifungal drugs), morphological studies, and virulence assessment in appropriate infection models.

How does structure-function analysis contribute to understanding pfa5 mechanism of action?

Structure-function analysis provides critical insights into pfa5's mechanism of action:

  • Structural elements of palmitoyltransferases:

    • DHHC cysteine-rich domain: Forms thioester intermediate with palmitoyl-CoA

    • Transmembrane domains: Position enzyme in appropriate membrane compartment

    • Substrate recognition domains: Determine specificity for particular proteins

  • Key methodological approaches:

    • Homology modeling based on related palmitoyltransferases

    • Identification of conserved motifs across species

    • Cysteine scanning mutagenesis to identify critical residues

    • Chimeric proteins to map substrate specificity determinants

  • Specific structure-function relationships to investigate:

    • Role of conserved DHHC motif in catalysis

    • Importance of transmembrane topology for accessing substrates

    • Identification of substrate binding sites

    • Structural basis for palmitoyl-CoA recognition

  • Advanced structural biology techniques:

    • X-ray crystallography of soluble domains

    • Cryo-EM analysis of the full-length membrane protein

    • NMR studies of specific domains

    • Molecular dynamics simulations of enzyme-substrate interactions

Understanding the structural basis of pfa5 function could facilitate rational design of inhibitors and provide insights into substrate specificity, potentially revealing why certain proteins are targeted for palmitoylation in Aspergillus fumigatus.

What role might pfa5 play in antifungal resistance mechanisms?

The potential role of pfa5 in antifungal resistance mechanisms represents an important area of investigation, given the rising concern about drug-resistant A. fumigatus strains :

  • Possible contributions to resistance:

    • Modification of membrane proteins affecting drug uptake or efflux

    • Palmitoylation of proteins involved in stress response pathways

    • Alteration of cell wall composition affecting drug penetration

    • Regulation of ergosterol biosynthesis pathway proteins (targets of azole antifungals)

  • Experimental approaches to investigate:

    • Comparative analysis of pfa5 expression in resistant vs. susceptible strains

    • Assessment of antifungal susceptibility in pfa5 knockout vs. wild-type strains

    • Proteomic identification of differentially palmitoylated proteins in resistant isolates

    • Testing whether pfa5 inhibition can sensitize resistant strains to antifungals

  • Clinical relevance:

    • Analysis of pfa5 sequence variations in clinical isolates with different antifungal susceptibilities

    • Correlation of pfa5 expression levels with treatment outcomes

    • Investigation of pfa5 as a biomarker for potential resistance

  • Synergistic drug targeting:

    • Evaluation of combined inhibition of pfa5 and conventional antifungal targets

    • Similar to the approach used with Neosartorya fischeri antifungal proteins, where combinations showed enhanced efficacy

Understanding pfa5's role in resistance could lead to combination therapies that enhance the efficacy of existing antifungals or overcome established resistance mechanisms.

How can protein-protein interactions of pfa5 be identified and validated?

Identifying and validating protein-protein interactions (PPIs) involving pfa5 requires a multi-method approach:

  • Discovery methods:

    • Yeast two-hybrid (Y2H) screening using pfa5 as bait

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Proximity-dependent biotin identification (BioID) or APEX2 proximity labeling

    • Co-immunoprecipitation (Co-IP) with antibodies against pfa5

  • Validation techniques:

    • Bimolecular fluorescence complementation (BiFC)

    • Förster resonance energy transfer (FRET)

    • Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC)

    • Split-luciferase complementation assays

    • Co-localization studies using fluorescently tagged proteins

  • Substrate vs. non-substrate interactions:

    • Differentiation between enzymatic substrates and regulatory interactors

    • Acyl-biotin exchange (ABE) or acyl-resin-assisted capture (Acyl-RAC) to identify palmitoylated proteins

    • Testing whether interaction depends on catalytic activity using pfa5 mutants

  • Contextual considerations:

    • Membrane environment requirements for interaction

    • Cell-state dependent interactions (hyphal vs. conidial, stress conditions)

    • Temporal dynamics of interactions during infection process

  • Systematic analysis of interaction networks:

    • Construction of pfa5-centered interactome

    • Integration with known virulence pathways

    • Identification of interaction hubs and potential drug targets

These approaches collectively provide a comprehensive understanding of pfa5's protein interaction network, offering insights into both its enzymatic substrates and regulatory mechanisms.

What approaches can be used to study the evolutionary conservation of pfa5 across fungal species?

Investigating the evolutionary conservation of pfa5 across fungal species provides valuable insights into its fundamental importance and potential as a species-specific drug target:

  • Phylogenetic analysis methods:

    • Multiple sequence alignment of pfa5 homologs

    • Construction of maximum likelihood or Bayesian phylogenetic trees

    • Analysis of selection pressures using dN/dS ratios

    • Identification of highly conserved vs. variable regions

  • Comparative genomics approaches:

    • Identification of pfa5 homologs across fungal genomes

    • Analysis of gene synteny and genomic context

    • Examination of copy number variations

    • Investigation of domain architecture conservation

  • Functional conservation assessment:

    • Cross-species complementation experiments

    • Comparison of substrate specificities between homologs

    • Analysis of expression patterns in different species

    • Testing antifungal susceptibility across species with pfa5 variants

  • Evolutionary insights from special cases:

    • Study of closely related species with different pathogenicity (e.g., A. fumigatus vs. A. fischeri)

    • Analysis of pfa5 in emerging resistant strains

    • Examination of convergent evolution in distantly related pathogenic fungi

  • Tools and resources:

    • FungiDB and AspGD databases for comparative genomics

    • MEGA, PhyML, or MrBayes for phylogenetic analyses

    • ConSurf for mapping conservation onto protein structures

    • InterProScan for domain identification across homologs

Understanding evolutionary patterns can reveal which regions of pfa5 are essential for function (potential drug targets) versus those that confer species-specific activities.

How can recombinant pfa5 be utilized in developing diagnostic tools for invasive aspergillosis?

Recombinant pfa5 offers potential applications in developing improved diagnostic tools for invasive aspergillosis, addressing the persistent challenge of early and accurate diagnosis:

  • Antibody-based detection systems:

    • Generation of anti-pfa5 antibodies using purified recombinant protein

    • Development of sandwich ELISA for detecting native pfa5 in clinical samples

    • Lateral flow immunoassays for point-of-care testing

    • Immunohistochemistry protocols for tissue biopsies

  • Serological diagnostic approaches:

    • Screening patient sera for anti-pfa5 antibodies as infection markers

    • Multiplex serological assays combining pfa5 with other A. fumigatus antigens

    • Analysis of antibody isotype distribution for staging infection

  • Nucleic acid-based detection:

    • Design of PCR primers targeting the pfa5 gene for direct detection

    • Development of isothermal amplification methods for rapid diagnosis

    • Use of recombinant pfa5 as positive control in molecular diagnostic assays

  • Comparative analysis with existing biomarkers:

    • Evaluation alongside established markers (galactomannan, β-D-glucan)

    • Assessment of sensitivity and specificity in different patient populations

    • Determination of optimal diagnostic algorithms incorporating pfa5 detection

  • Clinical validation requirements:

    • Testing in defined patient cohorts (neutropenic, transplant recipients, etc.)

    • Correlation with disease progression and treatment response

    • Comparison with gold standard diagnoses (culture, histopathology)

Similar to the allergen Asp f 2 from A. fumigatus , recombinant pfa5 could serve as both a diagnostic target and a standardization tool for developing more sensitive and specific tests for invasive aspergillosis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.