Recombinant Neosartorya fumigata Palmitoyltransferase swf1 (swf1)

Shipped with Ice Packs
In Stock

Description

Overview of Palmitoyltransferases in Neosartorya fumigata

Palmitoyltransferases (PATs) are enzymes that catalyze protein S-palmitoylation, a post-translational modification critical for membrane localization and protein function. N. fumigata encodes multiple PATs, including pfa3, pfa4, and pfa5, which are well-documented in commercial and academic sources . These enzymes share structural homology but differ in substrate specificity and cellular roles.

Table 1: Comparative Analysis of Recombinant N. fumigata Palmitoyltransferases

Featurepfa3 (Q4WZL8) pfa4 (Q4WC37) pfa5 (Q4WUK1)
Gene IDAFUA_2G16480AFUA_8G05830AFUA_5G08740
Protein Length548 aa428 aa443 aa
Expression HostE. coliE. coliE. coli
TagUndeterminedN-terminal HisN-terminal His
Purity>90% (SDS-PAGE)>90% (SDS-PAGE)>90% (SDS-PAGE)
Storage-20°C/-80°C in 50% glycerol-20°C/-80°C in 6% Trehalose-20°C/-80°C in 6% Trehalose
FunctionProtein fatty acylationS-acyltransferase activityMembrane protein anchoring

Notes:

  • pfa4 is the most extensively characterized, with full-length recombinant forms used for structural studies .

  • pfa3 and pfa5 are annotated as "protein fatty acyltransferase 3" and "5," respectively, but lack peer-reviewed functional studies .

Genomic and Proteomic Context

  • Gene Nomenclature: The "swf1" designation does not align with current gene naming conventions in N. fumigata. Validated PATs follow the "pfa" prefix (e.g., pfa3–pfa5) .

  • Homology: N. fumigata PATs share 30–40% sequence identity with Saccharomyces cerevisiae Swf1p, but no direct ortholog named "swf1" exists in N. fumigata databases.

Research Gaps and Recommendations

  1. Nomenclature Clarification: Verify if "swf1" refers to a newly discovered PAT or a synonym for existing pfa genes.

  2. Functional Studies: Prioritize knockout/knockdown experiments for pfa3–pfa5 to elucidate substrate specificity and pathogenicity roles.

  3. Structural Analysis: Use existing recombinant pfa4 (PDB-unpublished) as a template for homology modeling of uncharacterized PATs.

Pathogenic Relevance

  • Host Interaction: N. fumigata PATs mediate fungal survival by modifying virulence factors (e.g., hydrophobins) to evade immune recognition .

  • Therapeutic Target: PAT inhibition reduces fungal adhesion and biofilm formation in A. fumigatus , suggesting potential for antifungal drug development.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
swf1; AFUA_6G07570; Palmitoyltransferase swf1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-379
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
swf1
Target Protein Sequence
MCYYISILIYWGADCRTVGTGPVLMYCTKTIRSYFRCRHPFFSSINSSQIFFLSLLIAGE CMFIPSAWPRVSTFHRLFIPALALLPYVFLYASVVTKSYITHENHEDEMARYPYDRVIFN PGHRCRTCDFLKPARSKHCSFCKACVSRHDHHCVWLTNCVGRNNYHYFLSLLLSLSLMLA YGSWLGFSLVSQTLEGLIPSSSPLRSKSQDWTTWLNVWAIAIASDIRVGAVAMLTAMTAP LAMAFLLYHTYLIWAGMTTNESAKWSDWKEDVADGLVFKSTRSEIYGNQSHSDEDTPAQR TWPVSSNQILVITDGEPPKEGFQLCSRSNEILQKDDPQAPVDTRWTEVNSMREIDNIYDL GFWDNLREVFHMPIRRCVR
Uniprot No.

Target Background

Function
A palmitoyltransferase targeting several endosomal SNAREs. It palmitoylates SNAREs at cysteine residues near the cytoplasmic end of their transmembrane domains. It may play a role in the cellular quality control of transmembrane domain-containing proteins.
Database Links
Protein Families
DHHC palmitoyltransferase family, SWF1 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Neosartorya fumigata Palmitoyltransferase swf1 and what is its biological function?

Palmitoyltransferase swf1 (swf1) is a membrane-bound enzyme in Neosartorya fumigata (Aspergillus fumigatus) that catalyzes protein palmitoylation, a post-translational modification involving the covalent attachment of palmitate to cysteine residues of target proteins. Palmitoylation enhances protein membrane association and is critical for protein trafficking, stability, and function. In pathogenic fungi, palmitoyltransferases often play essential roles in virulence, morphogenesis, and stress responses. The swf1 protein contains DHHC-CRD (Asp-His-His-Cys cysteine-rich domain) catalytic motifs typical of palmitoyltransferases, as evident in its amino acid sequence .

How is swf1 structurally organized and what domains are critical for its function?

Based on sequence analysis, swf1 contains several characteristic domains:

  • Multiple transmembrane domains (predicted from hydrophobic regions in the sequence)

  • A conserved DHHC-CRD catalytic domain (identified by the presence of the cysteine-rich motif)

  • The amino acid sequence reveals a protein with a complex transmembrane topology that includes highly hydrophobic regions interspersed with charged residues

The CYYSISILIYWGAD sequence near the N-terminus suggests a membrane-associated region, while the CRTCDF sequence indicates part of the catalytic core. The protein's complex membrane topology is essential for its function in modifying target proteins within the cellular membrane system.

What experimental systems are available for studying swf1 function?

Researchers can approach swf1 functional studies through several experimental systems:

  • Recombinant protein expression systems: The availability of purified recombinant swf1 allows for in vitro enzymatic assays

  • Fungal genetic manipulation: Knockout or knockdown studies in A. fumigatus

  • Heterologous expression: Expression in model organisms like S. cerevisiae for complementation studies

  • Cell-based assays: Using human cell lines like A549 (as used for other A. fumigatus proteins) to study host-pathogen interactions

For optimal results, experiments should include appropriate controls such as catalytically inactive mutants (e.g., DHHC to DHHS mutations) and related proteins from non-pathogenic fungi.

How might swf1 contribute to A. fumigatus virulence mechanisms?

While specific data on swf1's role in virulence is not directly provided in the search results, we can draw informed parallels with other A. fumigatus virulence mechanisms:

  • Membrane protein regulation: swf1 likely modifies membrane proteins involved in host-pathogen interactions, similar to how HscA functions as a surface protein that interacts with host cell components

  • Evasion of host defense mechanisms: Much like how A. fumigatus HscA protein redirects phagosome maturation via p11, swf1-mediated palmitoylation may modify proteins involved in similar evasion strategies

  • Stress adaptation: Palmitoylation can regulate protein function under different environmental conditions, potentially contributing to A. fumigatus adaptation within the host

The clinical significance of A. fumigatus proteins is highlighted by the chronic nature of infections, particularly in immunocompromised patients such as those with chronic granulomatous disease (CGD) .

How does swf1 compare to palmitoyltransferases in other pathogenic fungi?

Comparative analysis reveals:

SpeciesPalmitoyltransferaseKey DifferencesShared Features
A. fumigatus (N. fumigata)swf1Complete 463 aa sequence with specific transmembrane organization DHHC-CRD domain
N. udagawaePredicted swf1 homologLikely differences in regulation based on distinct pathogenicity profiles Probable conservation of catalytic mechanism
Other Aspergillus speciesDHHC family proteinsSpecies-specific sequence variationsConservation of core catalytic domain

The genetic differences between Aspergillus species contribute to their distinct pathogenicity profiles, as demonstrated by the contrast between A. fumigatus and N. udagawae infections, with the latter causing more chronic disease (median duration of 35 weeks vs. 5.5 weeks for A. fumigatus) .

What potential protein targets might be palmitoylated by swf1 during infection?

Based on our understanding of fungal pathogenicity mechanisms, potential swf1 targets may include:

  • Cell wall integrity proteins: Proteins involved in cell wall remodeling during morphological transitions

  • Secreted virulence factors: Proteins that require membrane association before secretion

  • Signaling proteins: Membrane-associated signaling molecules that respond to host environments

  • Transporters: Nutrient transporters and efflux pumps potentially involved in antifungal resistance

The pathogenicity mechanism demonstrated by HscA protein, which anchors the host p11 protein on conidia-containing phagosomes and redirects them to non-degradative pathways, suggests A. fumigatus employs sophisticated protein-protein interactions during infection . Palmitoylation by swf1 could regulate such interactions.

What are the optimal conditions for storage and handling of recombinant swf1?

For optimal stability and activity, recombinant swf1 should be stored according to these guidelines:

  • Short-term storage: Working aliquots can be maintained at 4°C for up to one week

  • Long-term storage: Store at -20°C; for extended storage, -80°C is recommended

  • Buffer composition: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Freeze-thaw cycles: Avoid repeated freezing and thawing as this may compromise protein activity

Since palmitoyltransferases are membrane proteins, the presence of appropriate detergents or lipid environments may be crucial for maintaining native conformation and activity during experimental procedures.

What experimental approaches can be used to study swf1-mediated protein palmitoylation?

Researchers can employ several approaches to study swf1-mediated palmitoylation:

  • In vitro palmitoylation assays:

    • Using purified recombinant swf1

    • [³H]-palmitate or alkyne-palmitate labeling of substrate proteins

    • Detection via fluorography or click chemistry-based methods

  • Cell-based palmitoylation studies:

    • Expression in heterologous systems (yeast, mammalian cells)

    • Metabolic labeling with palmitate analogs

    • Acyl-biotin exchange (ABE) assay to detect palmitoylated proteins

  • Substrate identification methods:

    • Proteomic approaches combined with palmitoylation-specific enrichment

    • Yeast two-hybrid or proximity labeling to identify interacting proteins

These approaches should incorporate appropriate controls including inactive enzyme variants and inhibitors of palmitoylation.

How can researchers generate functional recombinant swf1 for in vitro studies?

Generating functional recombinant swf1 requires careful consideration of expression systems and purification strategies:

Expression strategies:

  • E. coli-based systems: May require optimization for membrane protein expression, possibly using strains like C41(DE3)

  • Yeast expression systems: S. cerevisiae or P. pastoris may provide more suitable eukaryotic environment

  • Insect cell systems: Baculovirus expression system offers advantages for complex eukaryotic proteins

  • Mammalian cell expression: HEK293 or CHO cells for highest structural fidelity

Purification considerations:

  • Detergent selection is critical (e.g., DDM, CHAPS, or NP-40)

  • Addition of lipids during purification may help maintain activity

  • Affinity tags should be positioned to avoid interference with transmembrane domains

  • The tag type will be determined during the production process to optimize for this specific protein

How can researchers distinguish between specific swf1 activity and other palmitoyltransferases?

Distinguishing specific swf1 activity requires careful experimental design:

  • Substrate specificity profiling:

    • Compare palmitoylation patterns using recombinant swf1 versus other DHHC proteins

    • Identify unique substrate recognition motifs

    • Use competition assays with known substrates

  • Inhibitor sensitivity analysis:

    • Determine differential sensitivity to palmitoyltransferase inhibitors

    • Develop swf1-specific inhibitors based on structural differences

  • Genetic approaches:

    • Create swf1 knockout/knockdown in A. fumigatus and assess which palmitoylated proteins are affected

    • Complementation studies with swf1 versus other palmitoyltransferases

The distinct growth characteristics of different Aspergillus species (such as the slower growth of N. udagawae compared to A. fumigatus sensu stricto) suggest species-specific protein functions that could extend to swf1.

What are the critical considerations when designing experiments to investigate swf1 function in pathogenicity?

When investigating swf1's role in pathogenicity, researchers should consider:

  • Model system selection:

    • In vitro cell culture models using relevant human cell lines (e.g., A549 lung epithelial cells)

    • Appropriate animal models of aspergillosis

    • Ex vivo organ cultures from susceptible tissues

  • Experimental variables to control:

    • Growth stage of A. fumigatus (conidia, swollen conidia, germlings)

    • Host cell type and activation state

    • Environmental conditions mimicking infection sites

  • Readouts for pathogenicity:

    • Cell damage assays (e.g., LDH release)

    • Fungal internalization and persistence

    • Phagosome maturation and acidification

    • Host immune response markers

Understanding the chronic nature of certain Aspergillus infections, particularly in immunocompromised hosts, is essential for designing experiments with appropriate timeframes .

How can researchers integrate swf1 functional data with broader pathogenicity mechanisms?

Integration of swf1 functional data requires multidisciplinary approaches:

  • Comparative analysis with other virulence factors:

    • Compare with well-characterized factors like HscA that influence host-pathogen interactions

    • Assess relative contributions to pathogenicity through combinatorial knockout studies

  • Systems biology approaches:

    • Network analysis of palmitoylated proteins in A. fumigatus

    • Integration with transcriptomic and proteomic data under infection-relevant conditions

  • Translational significance:

    • Correlation with clinical isolate characteristics

    • Assessment of swf1 expression or activity in resistant strains

    • Evaluation as a potential drug target

The identification of genetic factors associated with aspergillosis susceptibility, such as SNPs in host genes like S100A10 (p11) , provides context for understanding how fungal factors like swf1 interact with host determinants of disease susceptibility.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.