Recombinant Neosartorya fumigata Patatin-like phospholipase domain-containing protein AFUA_1G04970 (AFUA_1G04970)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please specify it in your order; we will prioritize its implementation.
Synonyms
AFUA_1G04970; Patatin-like phospholipase domain-containing protein AFUA_1G04970
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-712
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
AFUA_1G04970
Target Protein Sequence
MTSDEKSATRDIYDPNTLPDYDREFIEPDDLRQFEKALNAPEAAPLVALNDWRPVNQRVR KSRRTKPRRSKDETREGVLYTVLKWPFLFTVFAWITVLGFAYTLTRLYIFLYEQFVTWRG KREQLRRELSMQTNYQDWLKAAQALDTYLGNLKWKETDEYAYYDHLTINKVVAQLKQTRK AAEMEMQNGRPGLSDPPAVEELCFLLEACVKNNFAGVENPRLYSETYSGTKDLVQEYIDE VHSCIRLVLDSKQISNEDKYQFFKHLDTNFGRTALCLSGGATFAYYHFGVIRALLDNDVL PEIITGTSGGALVAALVATRTDEELKQLLVPALAHRIRACHEGFTTWVRRWWRTGARFDT LDWARQCSWFCRGSTTFREAYERTGRILNVSCVPSDPHSPTILANYLTSPDCVIWSAVLA SAAVPGILNPVVLMTKKRDGTLAPYSFGHKWKDGSLRTDIPIKALNLHFNVNFTIVSQVN PHINLFFFNSRGSVGRPVTHRKGRGWRGGFLGSAIEQYIKLDMNKWLRVLRHLELLPRPL GQDWSEIWLQKFSGTITIWPKSIPSDFYHILSDPSPERLARMLHVGKQSAFPKIQFIKNR LKIENAIMQGLQQCSSGGGRVMSPILSRRRQDRAQEHADRMVERLDQSFPERQSDYKDES HYAEVSDSLSATSSRPHTPDARRSSMFEEMRRQSAVFFDDPDMYADEDAVTT
Uniprot No.

Target Background

Function
Probable lipid hydrolase.
Database Links
Protein Families
PLPL family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the role of patatin-like phospholipases in fungal pathogenesis?

Patatin-like phospholipases (PLPs) are specialized enzymes that serve as important virulence factors in many pathogens, including fungi. These enzymes are capable of hydrolyzing phospholipids, particularly targeting the sn-1 and/or sn-2 positions of glycerophospholipids, which can disrupt host cell membranes during infection. In pathogenic fungi like Neosartorya fumigata, PLPs likely contribute to virulence by facilitating tissue invasion, nutrient acquisition, and potentially modulating host immune responses . Research methodologies to study their role typically involve creating gene knockout mutants, characterizing enzymatic activities using fluorogenic substrates such as PED-A1/BODIPY PC-A2, and conducting in vivo infection models to assess virulence differences between wild-type and mutant strains .

How does AFUA_1G04970 compare structurally with other fungal patatin-like phospholipases?

When analyzing the structural characteristics of AFUA_1G04970, researchers should employ bioinformatic approaches to compare its amino acid sequence with other characterized fungal PLPs. Key methodological steps include:

  • Performing multiple sequence alignments with other PLPs to identify conserved catalytic domains

  • Analyzing the presence of the characteristic active site serine and aspartate residues that form the catalytic dyad

  • Identifying the G-X-S-X-G motif typically found in the active site of PLPs

  • Conducting structural prediction using protein modeling software

Similar to approaches used with other PLPs, researchers should focus on identifying catalytic residues akin to the S214 and D407 sites described in other patatin-like proteins . Phylogenetic analysis will help position AFUA_1G04970 within the evolutionary context of fungal PLPs.

What are the optimal conditions for expressing recombinant AFUA_1G04970?

Based on methodologies used for similar phospholipases, the expression of recombinant AFUA_1G04970 typically requires:

  • Selection of an appropriate expression system (bacterial, yeast, or mammalian)

  • Optimization of codon usage for the selected host system

  • Incorporation of appropriate fusion tags (His-tag for purification)

  • Temperature optimization during expression

For bacterial expression systems like E. coli, researchers should test induction conditions at various temperatures (25°C, 37°C, and 42°C) as enzyme activity can be significantly affected by expression temperature . Purification protocols typically involve nickel affinity chromatography for His-tagged proteins followed by size exclusion chromatography to ensure high purity for subsequent enzymatic and structural studies.

What are the most effective assays for measuring AFUA_1G04970 phospholipase activity?

For quantitative assessment of AFUA_1G04970 phospholipase activity, researchers should consider these methodological approaches:

  • Fluorogenic substrate assays using PED-A1/BODIPY PC-A2 substrate with detection at excitation/emission wavelengths of 460/515 nm

  • Yolk agar plate assays for qualitative assessment of phospholipase activity (visualized as creamy white zones in halos)

  • Specific activity measurements using standard reaction conditions

A standardized protocol would include:

  • Preparation of substrate-liposome mix using DOPC, DOPG, and fluorogenic phospholipid substrate

  • Incubation at multiple temperatures (25°C, 37°C, and 42°C) to determine optimal enzymatic conditions

  • Measurement of fluorescence emission using spectrofluorometry

  • Calculation of specific activity expressed in U/mg of protein

Temperature (°C)Incubation TimeExpected PLA₁ Activity Range (U/mg)Expected PLA₂ Activity Range (U/mg)
2530 min0.5-2.0Minimal
374 hours1.0-3.00.2-1.0
424 hoursVariable0.3-1.5

Note: Exact values would need to be determined experimentally for AFUA_1G04970 .

How can site-directed mutagenesis be used to identify catalytic residues in AFUA_1G04970?

Site-directed mutagenesis represents a critical approach for identifying functional residues in AFUA_1G04970. The methodological workflow should include:

  • Identification of putative catalytic residues through sequence alignment with characterized PLPs

  • Design of primers for site-directed mutagenesis targeting conserved serine and aspartate residues

  • PCR-based mutagenesis to create single mutants (e.g., S→A and D→A) and double mutants

  • Verification of mutations by DNA sequencing

  • Expression and purification of wild-type and mutant proteins

  • Comparative enzymatic activity assays

Researchers should focus on creating mutations analogous to the S214A, D407A, and S214AD407A mutations described for other patatin-like phospholipases, as these typically represent the catalytic dyad in this enzyme family . Enzymatic assays comparing wild-type and mutant proteins will reveal the relative contribution of each residue to catalytic activity.

What in vivo models are appropriate for studying AFUA_1G04970's role in virulence?

To investigate the contribution of AFUA_1G04970 to N. fumigata virulence, researchers should consider these model systems:

  • Insect models: Galleria mellonella (greater wax moth) larvae represent an established model for studying fungal virulence. Methodologically, this involves:

    • Injecting conidia of wild-type and AFUA_1G04970 knockout strains

    • Monitoring mortality rates over time

    • Statistical analysis of survival curves using Kaplan-Meier methods

  • Murine models: For mammalian studies, researchers should:

    • Establish immunocompromised mouse models through cyclophosphamide treatment or genetic immunodeficiency

    • Administer conidia via intranasal or inhalation routes

    • Assess fungal burden in lung tissue, histopathological changes, and survival rates

Similar to studies with ergot alkaloid mutants in N. fumigata, researchers should create clean gene deletion mutants through homologous recombination, complemented strains, and potentially site-directed mutants to provide robust evidence for AFUA_1G04970's role in virulence .

How does AFUA_1G04970 interact with host immune components during infection?

Investigating AFUA_1G04970's interactions with host immunity requires sophisticated methodological approaches:

  • Transcriptomic analysis:

    • RNA-seq of host cells (e.g., macrophages, neutrophils) following exposure to wild-type vs. AFUA_1G04970 knockout strains

    • Pathway analysis to identify differentially regulated immune response genes

  • Immunological assays:

    • Cytokine profiling (IL-1β, TNF-α, IL-6) following host cell exposure

    • Neutrophil extracellular trap (NET) formation assessment

    • Phagocytosis and killing assays with primary immune cells

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with potential host targets

    • Surface plasmon resonance to quantify binding affinities

    • Fluorescence microscopy to track localization during host-pathogen interactions

Similar to studies examining ergot alkaloid contributions to virulence, researchers should employ complementary approaches to build a comprehensive understanding of how AFUA_1G04970 modulates host defenses .

What methodological approaches can resolve conflicting data about AFUA_1G04970 function?

When faced with contradictory results regarding AFUA_1G04970 function, researchers should implement:

  • Multi-laboratory validation studies with standardized:

    • Protein expression and purification protocols

    • Enzymatic activity assays with agreed-upon substrates and conditions

    • Genetic manipulation techniques for creating knockout strains

  • Strain-specific comparisons:

    • Parallel testing of multiple N. fumigata clinical and environmental isolates

    • Genetic complementation studies to confirm phenotype restoration

    • Whole-genome sequencing to identify potential compensatory mutations

  • Advanced statistical approaches:

    • Meta-analysis of published and unpublished datasets

    • Bayesian modeling to integrate diverse experimental outcomes

    • Power analysis to ensure adequate sample sizes for detecting biologically meaningful effects

These methodological considerations are particularly important given that different wild-type strains of N. fumigata can show significant phenotypic variation in virulence models .

How can structural biology approaches enhance understanding of AFUA_1G04970 mechanism?

Structural biology offers powerful insights into enzyme mechanisms through:

  • X-ray crystallography workflow:

    • High-purity protein preparation (>95% by SDS-PAGE)

    • Crystallization screening with varying precipitants, buffers, and additives

    • Data collection at synchrotron facilities

    • Structure determination and refinement

  • Cryo-electron microscopy approach:

    • Sample preparation on specialized grids

    • Image acquisition with direct electron detectors

    • Computational processing for 3D reconstruction

    • Model building and validation

  • Structure-guided functional studies:

    • Design of mutations based on structural data

    • Substrate docking simulations

    • Molecular dynamics to model conformational changes

These approaches would allow researchers to visualize the catalytic pocket of AFUA_1G04970, similar to methods used to characterize other phospholipases, and potentially identify unique structural features that could be targeted for antifungal development .

How should researchers normalize phospholipase activity data across different experimental systems?

For reliable cross-study comparisons of AFUA_1G04970 activity, researchers should implement these normalization approaches:

  • Standard curve calibration:

    • Include a commercial phospholipase standard (e.g., component D of EnzChek Phospholipase A₁/A₂ Assay Kit) in each experiment

    • Express activities relative to this standard

    • Report specific activity in standardized units (U/mg protein)

  • Data transformation protocols:

    • Log-transformation for skewed distributions

    • Z-score normalization for cross-platform comparisons

    • LOESS normalization for high-throughput screening data

  • Statistical validation:

    • Ensure normality of distributions after transformation

    • Apply appropriate statistical tests based on data characteristics

    • Report effect sizes alongside p-values

The methodology should include multiple technical and biological replicates, with all reactions conducted in triplicate as described for similar phospholipase activity measurements .

What bioinformatic pipelines are most appropriate for analyzing AFUA_1G04970 in the context of fungal virulence networks?

Researchers investigating AFUA_1G04970 within virulence networks should employ:

  • Comparative genomics approaches:

    • Ortholog identification across pathogenic fungi

    • Synteny analysis to identify conserved genomic contexts

    • Selection pressure analysis (dN/dS ratios) to identify evolutionarily conserved regions

  • Network analysis methods:

    • Co-expression analysis from RNA-seq data

    • Protein-protein interaction prediction

    • Gene ontology enrichment analysis

  • Integrative multi-omics approaches:

    • Integration of transcriptomic, proteomic, and metabolomic datasets

    • Construction of functional interaction networks

    • Machine learning algorithms to predict functional relationships

This multilayered approach allows researchers to position AFUA_1G04970 within the broader context of virulence mechanisms, similar to studies examining ergot alkaloid pathways and their interactions with other virulence factors in N. fumigata .

What are the most promising research avenues for understanding AFUA_1G04970 in clinical contexts?

Future research directions for AFUA_1G04970 should focus on:

  • Clinical strain diversity:

    • Comparative genomic analysis of AFUA_1G04970 sequences across clinical isolates

    • Correlation of sequence variations with antifungal resistance profiles

    • Analysis of AFUA_1G04970 expression levels in drug-resistant vs. susceptible isolates

  • Diagnostic applications:

    • Development of immunoassays targeting AFUA_1G04970 for invasive aspergillosis diagnosis

    • PCR-based detection methods for AFUA_1G04970 variants

    • Evaluation of AFUA_1G04970 as a biomarker in patient samples

  • Therapeutic targeting:

    • High-throughput screening for specific inhibitors

    • Structure-based drug design targeting catalytic residues

    • Evaluation of combination therapies targeting multiple virulence factors

These approaches could complement existing research on other virulence factors such as ergot alkaloids, potentially leading to more comprehensive strategies for combating invasive aspergillosis .

How can researchers integrate AFUA_1G04970 studies with systems biology approaches to fungal pathogenesis?

Integration of AFUA_1G04970 research into systems biology frameworks requires:

  • Mathematical modeling approaches:

    • Kinetic modeling of enzymatic activities

    • Agent-based modeling of host-pathogen interactions

    • Flux balance analysis incorporating AFUA_1G04970 into metabolic networks

  • Multi-scale integration methodologies:

    • Connecting molecular mechanisms to cellular phenotypes

    • Relating cellular behavior to tissue-level pathology

    • Linking tissue damage to clinical outcomes

  • Collaborative research frameworks:

    • Establishment of standardized protocols across research groups

    • Development of shared databases for AFUA_1G04970 variants and activities

    • Implementation of FAIR (Findable, Accessible, Interoperable, Reusable) data principles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.