Recombinant Neosartorya fumigata Protein get1 (get1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
get1; AFUB_063460; Protein get1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)
Target Names
get1
Target Protein Sequence
MLSLILTIFFVHVAIYLVNTVGATTIDTLLWILYLKLPTSTSRNARQQSRLKREVVQLKR EMNNTSSQDEFAKWAKLRRKHDKAMDEYEAMNKKLTAQKTSFDWSVKIARWLSTNGLKIF LQFYYSKTPVFALPAGWFPFYVEWVLSFPRAPRGSVSVQVWNSVCATAIAVMAEIVTSML LQLRSRSASPASTAKAQKAQ
Uniprot No.

Target Background

Function

Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. It functions as a membrane receptor for soluble Get3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol.

Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

How is the structure of Get1 organized and what domains are critical for its function?

  • Transmembrane Domains (TMDs): Get1 contains multiple transmembrane helices that anchor it in the ER membrane.

  • Cytosolic Domain: This region interacts with Get3 and is crucial for capturing the Get3-TA protein complex.

  • Luminal Regions: These portions face the ER lumen.

Research on homologous Get1 proteins shows that the cytosolic domains of Get1 and Get2 cooperate to strongly enhance their affinity for the Get3- TA complex, enabling efficient capture of the targeting complex . The transmembrane domains of Get1 are particularly important as they form part of a channel that facilitates the insertion of TA proteins into the ER membrane .

Experimental studies in yeast have shown that replacing Get1/2 transmembrane domains with those from unrelated ER membrane proteins, or mutating conserved residues (such as an aspartic acid near the middle of Get2 TM3), results in loss of function .

What are the optimal protocols for expressing and purifying recombinant N. fumigata Get1?

Expression System:

  • E. coli has been successfully used as an expression system for recombinant N. fumigata Get1

  • The full-length protein (amino acids 1-200) is typically expressed with an N-terminal His-tag for purification purposes

Purification Protocol:

  • Express the His-tagged Get1 in E. coli

  • Harvest cells and lyse using appropriate buffer systems

  • Purify using immobilized metal affinity chromatography (IMAC)

  • For higher purity, consider secondary purification steps (size exclusion or ion exchange chromatography)

  • The final product should have >90% purity as determined by SDS-PAGE

Buffer Composition and Storage:

  • Recommended storage buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

  • For long-term storage: Lyophilize the protein or store in buffer with 5-50% glycerol at -20°C/-80°C

  • Reconstitution: Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

  • Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week

What approaches can be used to study Get1 interactions with other components of the GET pathway?

Several methodologies have been successfully employed to study Get1 interactions:

  • Immunoprecipitation-Mass Spectrometry (IP-MS):

    • This approach has been used to identify Get1-interacting proteins

    • For example, researchers used Get1-GFP for immunoprecipitation followed by mass spectrometry to identify interacting partners

  • Ratiometric Bimolecular Fluorescence Complementation (rBiFC):

    • This technique can verify the orientation and interactions of Get1 with other proteins

    • Has been used to confirm interactions between Get1 and Get2

  • Co-Immunoprecipitation (Co-IP):

    • Leveraging 2in1 Förster resonance energy transfer (FRET) constructs

    • For example, fusion proteins of Get1-EGFP coexpressed with mCherry-tagged partners can be purified via RFP-trap antibody and analyzed by immunoblotting

  • Domain Interaction Studies:

    • Separating the cytosolic tail from the transmembrane domain region of Get1 to test which domains mediate interactions

    • Results have shown that TMDs are particularly important for Get1-Get2 interactions

  • S-protein Attachment Assays:

    • Used to study the targeting complexes

    • Mixing affinity-purified Get3 targeting complexes with S-protein in insertion buffer (22mM HEPES-KOH pH 7.4, 1.5mM Mg(OAc)2, 120mM KOAc, 2mM DTT, 14% glycerol, 0.75mM ATP, 25mM creatine phosphate and 330μg/ml creatine kinase)

How does the Get1/Get2 complex facilitate insertion of tail-anchored proteins into the ER membrane?

The Get1/Get2 complex functions as an insertase for tail-anchored proteins through a coordinated mechanism:

  • Capture Phase: The cytosolic domains of Get1 and Get2 cooperatively recognize and bind the Get3-TA protein complex. Complex assembly between these domains strongly enhances the affinity of individual subunits for Get3- TA, enabling efficient capture .

  • Conformational Remodeling: Upon binding to Get1/Get2, Get3 undergoes conformational changes that trigger the release of the TA protein:

    • Get1's cytosolic domain remodels Get3 conformation

    • Molecular recognition features (MoRFs) in Get2's cytosolic domain induce Get3 opening

    • Both subunits are required for optimal TA release from Get3

  • Channel Formation: Recent studies indicate that Get1/2 forms an aqueous channel in the membrane that facilitates insertion of the TA protein's transmembrane domain .

  • Insertion Process: Once released from Get3, the TA protein's hydrophobic transmembrane domain passes through the Get1/2 channel into the lipid bilayer of the ER membrane.

Mutations in the transmembrane domains of Get1/2 severely impact function, as measured by increased heat shock factor activity in yeast models, indicating compromised TA protein insertion leading to cytosolic aggregation .

What experimental systems can be used to assess Get1 function in the GET pathway?

Several experimental systems have been developed to study Get1 function:

  • Cell Reporter Systems:

    • GFP cell reporters of heat shock factor transcriptional activity can monitor TA protein aggregation in the cytosol due to compromised Get1/2 function

  • Yeast Genetic Models:

    • GET2-1sc fusion protein (where Get1 is linked to Get2 using a specific peptide linker) provides a functional system to study mutations

    • Various mutations in TMs can be introduced and their effects on function assessed

  • In vitro Reconstitution:

    • Reconstituted proteoliposomes containing purified Get1/Get2 complexes

    • Fluorescence-based assays to monitor TA protein insertion

    • Microfluidics assays to study channel formation by Get1/2 in reconstituted bilayers

  • Complementation Assays:

    • Testing whether plant or animal homologs of Get1 can complement yeast Get1 knockouts provides insight into functional conservation across species

    • For example, G1IP together with AtGET1 can complement growth defects of yeast receptor knockouts

  • Protein Engineering Approaches:

    • Get1 can be linked to Get2 using specific peptide sequences (e.g., ASGAGGSEGGGSEGGTSGAT) to create fusion proteins for functional studies

How does the structure and function of N. fumigata Get1 compare to homologs from other species?

The GET pathway shows interesting patterns of conservation and divergence across eukaryotes:

Structural Conservation Despite Sequence Divergence:

Species Comparisons:

  • Yeast (S. cerevisiae) vs. N. fumigata:

    • Both function in the GET pathway with similar mechanisms

    • Key functional domains are preserved despite sequence differences

  • Mammalian Homologs:

    • The mammalian homolog of Get1 is WRB

    • CAML serves as the Get2 homolog

    • These form a receptor complex similar to the fungal Get1/Get2

  • Plant Homologs:

    • AtGET1 has been identified in Arabidopsis thaliana

    • G1IP (At4g32680) functions as a plant-specific GET2

    • Only transmembrane domains and small sequence motifs are conserved across eukaryotes

Functional Assays Across Species:

  • Expression of the charged stretch at the N terminus of plant G1IP is sufficient to interrupt TA protein import in dog reticulocytes, showing functional conservation across vast evolutionary distances

  • Experiments have shown that G1IP together with AtGET1 can complement growth defects of yeast receptor knockouts, suggesting pathway conservation despite sequence divergence

What are the methodological challenges in studying membrane protein complexes like Get1/Get2?

Studying the Get1/Get2 complex presents several technical challenges:

  • Expression and Purification Challenges:

    • Membrane proteins are often difficult to express in soluble, functional form

    • Maintaining proper folding and avoiding aggregation requires optimization of expression conditions

    • Detergent selection is critical for extraction from membranes while preserving native structure

  • Reconstitution for Functional Studies:

    • Proper reconstitution into liposomes or nanodiscs is essential for functional studies

    • Lipid composition can significantly affect activity and needs to be optimized

  • Structural Analysis Limitations:

    • Traditional structural biology techniques (X-ray crystallography, NMR) are challenging for membrane proteins

    • Cryo-EM has emerged as an alternative but still presents challenges for smaller membrane proteins

  • Capturing Transient Interactions:

    • The Get1/Get2-Get3-TA protein interaction involves multiple steps and conformational changes

    • Capturing these transient states requires specialized techniques

Innovative Approaches to Address These Challenges:

  • Protein engineering, such as creating Get2-1sc fusions, where Get1 is linked to Get2 using specific peptide linkers

  • Using microfluidics assays to study channel formation in reconstituted bilayers

  • Employing ratiometric bimolecular fluorescence complementation (rBiFC) to study protein-protein interactions and topology

  • Developing cell-free expression systems specifically optimized for membrane proteins

What is known about the relationship between Get1 function and fungal pathogenicity in N. fumigata?

While direct evidence linking Get1 function to N. fumigata pathogenicity is limited in the provided search results, we can make informed connections based on the biological context:

  • Role in Cellular Protein Homeostasis:

    • The GET pathway is essential for proper localization of many tail-anchored proteins, including SNAREs involved in vesicle fusion

    • Disruption of this pathway could impact cellular stress responses and protein homeostasis

    • N. fumigata pathogenicity depends on its ability to respond to environmental stresses in the host

  • Potential Connections to Virulence Factors:

    • N. fumigata has several virulence factors, including elastases and proteases that are secreted and help break down human lung tissue

    • The secretory pathway, which depends on properly localized SNAREs, is crucial for the export of these virulence factors

    • Get1 dysfunction could potentially impact the secretion of virulence factors

  • Nitrogen Assimilation and Metabolism:

    • N. fumigata's ability to assimilate nitrogen is of clinical importance and affects virulence

    • The GET pathway may indirectly influence metabolic processes that contribute to virulence

  • Research Directions:

    • Investigating whether Get1 mutations affect the secretion of known virulence factors

    • Examining if Get1 function impacts N. fumigata's response to host immune defenses

    • Studying whether the GET pathway plays a role in the fungus's ability to survive in different host environments

  • Host-Pathogen Interactions:

    • Recent research has shown that N. fumigata can hijack human proteins (e.g., p11) to redirect fungal phagosomes and escape intracellular killing

    • The GET pathway might be involved in maintaining the membrane proteins necessary for these host-pathogen interactions

What biosafety considerations should researchers be aware of when working with recombinant N. fumigata proteins?

Working with recombinant N. fumigata proteins, including Get1, requires attention to several biosafety considerations:

How can researchers use recombinant N. fumigata Get1 to study the GET pathway in pathogenic fungi?

Recombinant N. fumigata Get1 offers several research applications:

  • Comparative Studies of GET Pathway Components:

    • Comparing the biochemical properties of Get1 from pathogenic fungi with non-pathogenic species

    • Identifying fungal-specific features that might serve as targets for antifungal development

  • Structure-Function Analysis:

    • Using site-directed mutagenesis to identify critical residues for Get1 function

    • Investigating the impact of these mutations on TA protein insertion

    • Creating chimeric proteins with Get1 domains from different species to identify species-specific functions

  • Protein-Protein Interaction Studies:

    • Using recombinant Get1 to identify and characterize interactions with other components of the GET pathway

    • Pull-down assays, FRET, or surface plasmon resonance to quantify binding affinities and kinetics

  • Reconstitution Experiments:

    • Reconstituting the Get1/Get2 complex in liposomes to study membrane insertion of TA proteins

    • Testing whether N. fumigata Get1 can functionally replace Get1 from other species in reconstituted systems

  • Antibody Development:

    • Using recombinant Get1 to generate antibodies for immunolocalization studies

    • Tracking Get1 distribution within fungal cells under different conditions

  • Drug Discovery Applications:

    • Screening for small molecules that specifically disrupt Get1 function or Get1-Get3 interactions

    • Evaluating whether disruption of the GET pathway affects fungal viability or virulence

What recent technological advances might improve our understanding of Get1 structure and function?

Several cutting-edge technologies show promise for advancing Get1 research:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Recent advances in cryo-EM have revolutionized structural studies of membrane proteins

    • Could provide high-resolution structures of the Get1/Get2 complex in different functional states

  • Integrative Structural Biology:

    • Combining multiple structural techniques (X-ray crystallography, NMR, SAXS, cryo-EM)

    • Computational modeling to integrate diverse structural data

  • Advanced Fluorescence Techniques:

    • Single-molecule FRET to monitor conformational changes during TA protein insertion

    • Super-resolution microscopy to visualize Get1 distribution and dynamics in cells

  • Microfluidics and Nanodiscs:

    • Advanced membrane protein reconstitution in nanodiscs for functional studies

    • Microfluidics platforms to study channel formation and membrane insertion kinetics

  • CRISPR-Cas9 Genome Editing:

    • Creating precise mutations in endogenous Get1 to study function in the native context

    • Has been used successfully to create loss-of-function lines in GET pathway studies

  • Computational Approaches:

    • Molecular dynamics simulations to study Get1/Get2 channel dynamics

    • Machine learning algorithms to predict functional consequences of mutations

  • Mass Spectrometry Innovations:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to study protein dynamics

    • Cross-linking mass spectrometry to map protein-protein interaction interfaces

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.