Recombinant Neosartorya fumigata Protein yop1 (yop1)

Shipped with Ice Packs
In Stock

Description

Basic Characteristics and Identification

yop1 is classified as a recombinant protein produced via heterologous expression systems. Key identifiers include:

  • Species: Neosartorya fumigata (strains ATCC MYA-4609, Af293, CBS 101355, FGSC A1100) .

  • UniProt ID: Q4WTW3 .

.

Research Gaps and Limitations

The provided sources lack experimental data on yop1’s biological activity, localization, or interaction partners. Notably:

  • No Antifungal Activity: Unlike Neosartorya fischeri antifungal protein (NFAP) , yop1 is not described as having antimicrobial properties.

  • No Disease Association: Unlike Asp f I (a ribotoxin in A. fumigatus) , yop1 is not linked to pathogenicity or allergenicity in current literature.

Comparative Analysis with Related Proteins

While yop1 is distinct from other Aspergillus-derived proteins, insights can be drawn from analogous systems:

ProteinSourceFunctionKey Features
yop1N. fumigataUndetermined169 aa, recombinant production
NFAPN. fischeriAntifungal, β-defensin-like57 aa, cysteine-rich
Asp f IA. fumigatusRibotoxin, allergen18 kDa, sporulation-dependent
Ypd1A. fumigatusPhosphotransfer protein (HOG pathway)Essential for stress signaling

Future Directions

To advance understanding of yop1, targeted studies are required:

  • Functional Characterization: Investigate subcellular localization (e.g., GFP-tagged yop1) and interaction networks.

  • Stress Response: Explore potential roles in osmotic, oxidative, or thermal stress pathways, analogous to Ypd1 .

  • Comparative Genomics: Identify orthologs in other Aspergillus species to infer conserved functions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate special requests. Please specify your desired format in the order notes, and we will fulfill your requirement whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal results, briefly centrifuge the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be chosen during production. If you have a preference for a particular tag, please inform us, and we will prioritize its use in development whenever possible.
Synonyms
yop1; AFUA_5G06320; Protein yop1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-169
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
yop1
Target Protein Sequence
MASFQDRAQHTIAQLDKELSKYPVLNNLERQTSVPKVYVILGLVGIYTFLVFFNIAGEFL VNFAGFLIPGYYSLNALFTSGKADDTQWLTYWVVYALLTVVESAINAAYWFPFYYIFKFV LILWMSLPQTNGAQVVFHSFLQPVLGRFFTSGSTSANLRAQADAASKSQ
Uniprot No.

Target Background

Function
Recombinant Neosartorya fumigata Protein yop1 (yop1) is involved in membrane/vesicle trafficking.
Database Links
Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Protein Characterization and Structure

Q: What is the basic structural characterization of Neosartorya fumigata Protein yop1?

A: Neosartorya fumigata Protein yop1 (yop1) is a 169-amino acid protein encoded by the yop1 gene (ORF: AFUA_5G06320) in Neosartorya fumigata (strain ATCC MYA-4609/Af293/CBS 101355/FGSC A1100), also classified as Aspergillus fumigatus. The full amino acid sequence is: MASFQDRAQHTIAQLDKELSKYPVLNNLERQTSVPKVYVILGLVGIYTFLVFFNIAGEFLVNFAGFLIPGYYSLNALFTSGKADDTQWLTYWVVYALLTVVESAINAAYWFPFYYIFKFVLILWMSLPQTNGAQVVFHSFLQPVLGRFFTSGSTSANLRAQADAASKSQ . Analysis of the sequence suggests it contains multiple transmembrane domains, consistent with its putative role in membrane organization.

Q: What is the cellular localization pattern of yop1 in Neosartorya fumigata?

A: Based on sequence analysis and comparison with homologous proteins, yop1 in N. fumigata is predicted to localize to the endoplasmic reticulum (ER) membrane. While specific localization studies of N. fumigata yop1 are not abundantly documented, research on related fungal proteins suggests that visualization techniques using GFP-fusion proteins can be effective. For example, studies with GFP-Ypd1 fusion in A. fumigatus revealed both cytoplasmic and nuclear localization . To determine yop1 localization, researchers should consider similar approaches using fluorescence microscopy with GFP-yop1 fusion constructs, potentially co-stained with organelle markers for the ER and other membrane compartments.

Production and Purification Protocols

Q: What are the optimal expression systems for producing recombinant N. fumigata yop1?

Q: What are the recommended storage conditions for preserving recombinant yop1 activity?

A: Based on available product information, recombinant N. fumigata yop1 should be stored in Tris-based buffer with 50% glycerol at -20°C, with extended storage recommended at -80°C . Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided to prevent protein degradation . For functional studies, buffer optimization may be necessary, potentially including stabilizing agents such as glycerol or specific detergents for this membrane protein.

Functional Assays and Analysis

Q: What methodological approaches can be used to assess yop1 function in vitro?

A: To assess yop1 function in vitro, researchers can employ several methodological approaches:

  • Membrane binding assays: Using liposomes of defined composition to evaluate protein-membrane interactions and potential membrane remodeling activities.

  • Protein-protein interaction studies: Methods such as co-immunoprecipitation, yeast two-hybrid, or pull-down assays to identify binding partners in the ER network.

  • Electron microscopy: To visualize membrane morphology changes induced by recombinant yop1.

  • Circular dichroism (CD) spectroscopy: To evaluate structural changes under different conditions, similar to approaches used with other fungal proteins like NFAP .

These methodologies should be adapted considering yop1's hydrophobic nature and membrane association, potentially requiring detergent-solubilized preparations or reconstitution into membrane mimetics.

Role in Fungal Biology and Pathogenicity

Q: How does yop1 contribute to Neosartorya fumigata pathogenicity?

A: The specific contribution of yop1 to N. fumigata pathogenicity has not been fully characterized, but understanding can be guided by research on other essential proteins in this pathogen. Studies on A. fumigatus demonstrate that proteins involved in stress signaling pathways contribute significantly to the pathogen's ability to adapt to various stress conditions . Research approaches to investigate yop1's role in pathogenicity should include:

  • Generation of conditional mutants (similar to tet-on promoter constructs used for essential genes like ypd1)

  • Phenotypic characterization under infection-relevant conditions

  • Host-pathogen interaction studies examining the impact of yop1 modulation on virulence

N. fumigata's thermotolerance is a key virulence factor, with growth capabilities at temperatures up to 42°C (though not at higher temperatures like A. fumigatus which grows at 55°C) . Investigating yop1's role in membrane stability under temperature stress could provide insights into its contribution to pathogenicity.

Q: How do species differences between Neosartorya and Aspergillus affect interpretation of yop1 functional studies?

A: Interpretation of yop1 functional studies requires careful consideration of species differences between Neosartorya and Aspergillus. Phylogenetic analyses demonstrate that Neosartorya species form distinct monophyletic clusters with significant distance from Aspergillus fumigatus . Key biological differences include:

  • Thermotolerance profiles: While A. fumigatus grows at temperatures up to 55°C but not at 10°C, Neosartorya species like N. udagawae grow at 10°C but not above 42°C .

  • Germination kinetics: Neosartorya conidia typically require longer incubation periods to germinate at 37°C compared to Aspergillus .

  • Stress resistance: Differential susceptibility to neutrophil attack and hydrogen peroxide has been observed between species .

These biological differences suggest potentially distinct functional adaptations of cellular proteins, including yop1, which should be considered when extrapolating findings between Neosartorya and Aspergillus species.

Experimental Design Considerations

Q: What controls are essential when designing experiments with recombinant yop1?

A: When designing experiments with recombinant N. fumigata yop1, researchers should implement several critical controls:

  • Protein quality controls:

    • SDS-PAGE and western blot analysis to confirm protein purity and integrity

    • Circular dichroism to verify proper folding

    • Size exclusion chromatography to assess oligomeric state

  • Functional controls:

    • Heat-inactivated yop1 samples to distinguish between specific and non-specific effects

    • Tagged protein controls to account for tag-related artifacts

    • Dose-response experiments to establish concentration-dependent effects

  • Comparative controls:

    • Parallel experiments with homologous proteins from related species to identify conserved versus species-specific functions

    • Empty vector or irrelevant protein controls for cell-based assays

These controls help distinguish genuine biological activities from technical artifacts, particularly important when working with membrane proteins that can have non-specific effects on lipid bilayers.

Structural Biology and Protein Interactions

Q: What approaches are most effective for resolving the structure of membrane-associated yop1?

A: Resolving the structure of membrane-associated yop1 presents significant challenges requiring specialized approaches:

  • Cryo-electron microscopy (cryo-EM): Particularly suitable for membrane proteins, allowing visualization in near-native states. Sample preparation would involve reconstitution into nanodiscs or amphipols to maintain membrane environment.

  • X-ray crystallography: Requires extensive optimization of crystallization conditions with appropriate detergents. Crystallization chaperones or antibody fragments may facilitate crystal formation.

  • Nuclear magnetic resonance (NMR) spectroscopy: While challenging for full-length yop1, this approach could be valuable for studying specific domains or peptide fragments in membrane mimetics.

  • Computational approaches: Homology modeling based on structurally characterized homologs combined with molecular dynamics simulations in membrane environments can provide preliminary structural insights.

Each approach has distinct advantages and limitations for membrane proteins like yop1, and researchers may need to employ multiple complementary techniques to fully resolve structural details.

Q: How can protein-protein interaction networks involving yop1 be systematically mapped?

A: Systematically mapping protein-protein interaction networks involving yop1 requires specialized approaches for membrane proteins:

  • Proximity-dependent biotinylation (BioID or TurboID): By fusing biotin ligase to yop1, researchers can identify proximal proteins in the native cellular environment, particularly valuable for membrane-associated complexes.

  • Split-reporter systems: Techniques like split-GFP or split-luciferase can detect interactions in native membrane environments with minimal disruption.

  • Co-immunoprecipitation with crosslinking: Chemical crosslinking prior to solubilization helps preserve transient or weak interactions that might be disrupted during membrane protein extraction.

  • Quantitative proteomics: SILAC or TMT-based approaches comparing wild-type and yop1-depleted conditions can identify functionally relevant interaction partners.

  • Genetic interaction mapping: Synthetic genetic array analysis or CRISPR-based screens can identify functional relationships even when physical interactions are difficult to detect.

These methodologies should be applied in conjunction with bioinformatic analysis of potential interaction networks based on known functions of homologous proteins in related species.

Therapeutic Target Potential

Q: What evidence supports targeting yop1 for antifungal development?

A: The evaluation of yop1 as a potential antifungal target should consider several factors:

  • Essentiality: While the essentiality of yop1 specifically has not been directly demonstrated in the provided search results, research on other proteins in N. fumigata/A. fumigatus reveals that membrane organization proteins can be essential for fungal viability. For example, Ypd1 has been shown to be an essential protein in A. fumigatus, with its depletion resulting in a lethal phenotype .

  • Conservation and specificity: An ideal antifungal target would show significant differences from human homologs. Comprehensive sequence analysis comparing fungal yop1 with human counterparts would be required to assess targeting specificity.

  • Druggability: Membrane proteins like yop1 offer potential binding pockets for small molecule inhibitors. Structure-based drug design approaches could exploit unique structural features of the fungal protein.

  • Precedent from related targets: The stress signaling HOG pathway in A. fumigatus is already known to be a target for antifungal agents like fludioxonil or pyrrolnitrin , suggesting that proteins involved in membrane organization and stress responses can be viable therapeutic targets.

Research strategies should include conditional knockdown studies to assess phenotypic consequences of yop1 depletion and high-throughput screening to identify potential inhibitors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.