Recombinant Neosartorya fumigata Protoheme IX farnesyltransferase, mitochondrial (cox10)

Shipped with Ice Packs
In Stock

Description

Introduction and Definition

Recombinant Neosartorya fumigata Protoheme IX farnesyltransferase, mitochondrial (Cox10) is a genetically engineered enzyme derived from the AFUA_4G08340 gene of Neosartorya fumigata, a pathogenic fungus. This protein catalyzes the farnesylation of protoheme IX to form heme O, a critical step in heme A biosynthesis for mitochondrial cytochrome c oxidase (COX) assembly . Its recombinant variants are produced in heterologous systems (e.g., E. coli, yeast, baculovirus, or mammalian cells) and purified to ≥85% homogeneity via SDS-PAGE .

Biological Role and Functional Significance

Cox10 is essential for heme A synthesis, a prosthetic group in COX, the terminal enzyme of the mitochondrial electron transport chain. Defects in Cox10 disrupt COX activity, leading to mitochondrial dysfunction . In Neosartorya fumigata, Cox10’s role extends to antifungal resistance mechanisms. A study identified a R243Q mutation in AfCox10 (AFUB_065450) that confers azole resistance by reducing itraconazole absorption .

Azole Resistance and Mutational Insights

  • Mutation Identification: Next-generation sequencing (NGS) revealed a R243Q substitution in AfCox10 linked to itraconazole resistance in A. fumigata .

  • Mechanistic Analysis: HPLC confirmed decreased intracellular itraconazole accumulation in mutants, implicating altered heme biosynthesis in resistance .

  • Complementation Studies: Reintroducing the wild-type AfCox10 restored itraconazole sensitivity, validating its role in resistance .

StudyKey FindingsMethodology
PubMed Study (2016)R243Q mutation in AfCox10 reduces azole efficacy via impaired drug uptake.NGS, HPLC, complementation
MyBioSource DataRecombinant Cox10 retains enzymatic activity in heterologous systems.SDS-PAGE, biochemical assays

Applications and Relevance

  • Antifungal Research: Cox10 serves as a target for studying resistance mechanisms in A. fumigata, a major cause of invasive aspergillosis .

  • Biochemical Assays: Recombinant Cox10 is used to investigate heme biosynthesis pathways and validate enzyme activity in vitro .

  • Therapeutic Targeting: Mutations in Cox10 highlight its potential as a target for developing novel antifungals that exploit heme biosynthesis vulnerabilities .

Comparative Insights

While Cox10 in Neosartorya fumigata shares functional homology with human COX10, its role in fungal pathogenesis diverges. For example:

  • Human COX10: Mutations cause cytochrome c oxidase deficiency .

  • Fungal Cox10: Mutations contribute to antifungal resistance, as seen in A. fumigata .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify it in your order remarks. We will prepare the product according to your requirements.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
cox10; AFUA_4G08340; Protoheme IX farnesyltransferase, mitochondrial; Heme O synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
48-512
Protein Length
Full Length of Mature Protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
Target Protein Sequence
AGIADHESTPSTVQKTYFSANRTADGLLASLSAVNSSPRSIADNALSQGAASSESITSQS TSQELPHRRRKRLKEEAAKNNAAETELPPDASSQLSTLSSALPATSLRRKLAAFLALTKP RLSFLIVLTTTSAYGMYPISSLLTLDPSMTPLPTLSTSTLTFLYLTTGTFLSSCSANTLN MLLEPKYDALMSRTRNRPLVRGLLSRRAAVLFAIATAAAGLGLLYIGTNPTTTALSASNI CLYAFVYTPLKRISVINTWVGAVVGGIPPLMGWTAAAGQTATTGHDSWRDMLFSKDSIGG WLLGGILFAWQFPHFNALSYMIREEYKAAGYRMLAWTNPAANARVALRYSLLMFPFSVGL WWVGVVGNGFLVGSTAANGWLVKEAYKFWRHQGANGSARRLFWASIWQLPILLVGGLVTK KGLWDGVWNNVFGQPVEDEDDYLWEDEDEVAEAERKMIPAKTSSS
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of protoheme IX and farnesyl diphosphate to heme O.
Database Links
Protein Families
UbiA prenyltransferase family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Protoheme IX farnesyltransferase (Cox10) and what is its function?

Cox10 is a farnesyltransferase involved in the synthesis of heme a, which forms part of the catalytic core of cytochrome c oxidase (COX), also known as complex IV in the mitochondrial electron transport chain. In Neosartorya fumigata (Aspergillus fumigatus), the Cox10 protein is also referred to as Heme O synthase .

The enzyme catalyzes a rate-limiting step in oxidative phosphorylation (OXPHOS), making it crucial for cellular energy production. Cox10 functions by transferring a farnesyl group to protoheme IX, which is an essential step in heme a biosynthesis. Defects in complex IV, including Cox10 deficiency, have been linked to mitochondrial diseases in humans, and studies in mouse models have shown that Cox10 is required for maximal T cell proliferation during viral infection .

How is recombinant Cox10 from Neosartorya fumigata typically produced?

Recombinant Neosartorya fumigata Cox10 can be produced using multiple expression systems, each offering specific advantages depending on research requirements:

Expression SystemProduct Code ExampleSpecial FeaturesApplications
YeastCSB-YP687239NGS1Close to native eukaryotic foldingStructural studies
E. coliCSB-EP687239NGS1High yield productionBasic biochemical assays
E. coli with BiotinylationCSB-EP687239NGS1-BIn vivo biotinylation via AviTag-BirA technologyProtein interaction studies
BaculovirusCSB-BP687239NGS1Post-translational modificationsFunctional studies
Mammalian cellCSB-MP687239NGS1Most authentic eukaryotic modificationsComplex functional assays

The protein is typically provided as a lyophilized powder with purity >85% as determined by SDS-PAGE . For biotinylated versions, the BirA ligase catalyzes an amide linkage between biotin and a specific lysine residue of the AviTag peptide, enabling site-specific biotinylation for specialized applications .

How does Cox10 function in the electron transport chain?

Cox10 plays an indirect but essential role in the electron transport chain by catalyzing a critical step in heme a biosynthesis. This methodological process involves:

  • Cox10 adds a farnesyl group to protoheme IX, creating heme o

  • Heme o is subsequently converted to heme a by Cox15

  • Heme a is incorporated into cytochrome c oxidase (Complex IV)

  • Complex IV uses heme a as a cofactor for electron transfer to molecular oxygen

  • This electron transfer is coupled to proton translocation across the inner mitochondrial membrane

  • The resulting proton gradient drives ATP synthesis

Experimentally, the importance of Cox10 in oxidative metabolism has been demonstrated in various models. In NK cells with Cox10 deficiency, there was impaired expansion of antigen-specific cells during viral infection despite an increase in glycolysis, indicating that oxidative metabolism through Cox10 function is specifically required for antigen-driven proliferation .

What research tools are available for studying Cox10?

Several research tools are available for studying Cox10:

  • Recombinant proteins: Multiple expression systems provide Cox10 with varying tags and post-translational modifications

  • Genetic models: Mouse models with inducible cell-specific Cox10 deletion (e.g., Ncr1-Cox10Δ/Δ) have been developed to study its function in specific cell types

  • Antibodies: Commercially available antibodies against Cox10 for immunoblotting, immunoprecipitation, and immunofluorescence studies

  • Activity assays: Spectrophotometric methods to measure farnesyltransferase activity

  • Genomic analysis tools: For studying cox10 variations across different A. fumigatus populations, which show structured patterns of genetic variation

These tools enable comprehensive analysis of Cox10 function from molecular to organismal levels, supporting both basic and translational research applications.

What experimental considerations are important when working with recombinant Cox10?

When designing experiments with recombinant Cox10, researchers should consider:

  • Expression system selection: The choice between yeast, E. coli, baculovirus, or mammalian expression systems significantly impacts protein functionality. For enzymatic assays, eukaryotic systems may better preserve native activity, while E. coli may be preferred for high-yield structural studies .

  • Membrane protein handling: As a membrane-associated protein, Cox10 requires appropriate detergents or membrane mimetics to maintain solubility and structure. Consider using digitonin, DDM, or nanodiscs for functional studies.

  • Storage and stability: Store lyophilized protein at -20°C and for extended storage at -80°C. Avoid repeated freeze-thaw cycles. Working aliquots can be maintained at 4°C for up to one week .

  • Reconstitution conditions: Reconstitute in Tris-based buffer with 50% glycerol that has been optimized for protein stability . The buffer composition may need optimization depending on the specific application.

  • Cofactor requirements: For functional studies, consider supplementing with appropriate cofactors such as farnesyl pyrophosphate and protoheme IX.

  • Experimental controls: Include appropriate controls such as heat-inactivated protein or known Cox10 inhibitors to validate assay specificity.

How can researchers measure the enzymatic activity of recombinant Cox10?

Measuring Cox10 farnesyltransferase activity requires specialized methodological approaches:

  • Spectrophotometric assays: Monitor the conversion of protoheme IX to heme o by measuring absorbance changes at specific wavelengths:

    • Prepare reaction mixture containing recombinant Cox10, protoheme IX, and farnesyl pyrophosphate

    • Monitor absorbance changes at 400-450 nm (Soret band region)

    • Calculate activity based on extinction coefficient differences between substrate and product

  • HPLC analysis:

    • Perform the enzymatic reaction under optimal conditions

    • Extract heme compounds using acidified acetone

    • Separate protoheme IX, heme o, and heme a by reverse-phase HPLC

    • Quantify using appropriate standards and detection at 400 nm

  • Mass spectrometry:

    • Conduct the enzymatic reaction

    • Extract and purify reaction products

    • Analyze by LC-MS to detect the mass shift associated with farnesyl addition

    • Confirm product identity through MS/MS fragmentation patterns

  • Cellular assays:

    • Introduce recombinant Cox10 into Cox10-deficient cells

    • Measure restoration of complex IV assembly by blue native PAGE

    • Assess cytochrome c oxidase activity using oxygen consumption assays

    • Quantify heme a content in cellular extracts

These methodologies provide complementary information about Cox10 activity and can be selected based on the specific research question and available equipment.

What is known about genetic variation of cox10 across different A. fumigatus populations?

Population genomic studies have revealed important insights about genetic variation in A. fumigatus:

  • Population structure: Research has identified three primary populations of A. fumigatus with distinct genetic profiles . These populations show structured patterns of gene presence-absence variation.

  • Recombination patterns: A. fumigatus exhibits extraordinarily high levels of recombination, with the lowest linkage disequilibrium decay value reported for any fungal species . Recombination occurs frequently within populations but rarely between them.

  • Pan-genomic analysis: Pan-genomic approaches reveal that many genes, potentially including cox10 variants, are not captured in reference-based analyses, highlighting the importance of de novo assembly approaches .

  • Metabolic specialization: Accessory genes (those not present in all strains) show functional enrichment for nitrogen and carbohydrate metabolism, suggesting that the three populations may be stratified by environmental niche specialization .

  • Phylogenetic distribution: The distribution of antifungal resistance genes and resistance alleles is often structured by phylogeny , which may include metabolic genes like cox10 that could contribute to fitness in different environments.

To study cox10 variations methodologically, researchers should:

  • Perform whole-genome sequencing across multiple strains

  • Use both reference-based and pan-genomic analyses

  • Conduct functional studies to determine the phenotypic impact of identified variants

  • Correlate genetic variations with ecological niches or clinical outcomes

How does Cox10 deficiency affect oxidative metabolism?

Cox10 deficiency has significant effects on cellular metabolism, as demonstrated in various experimental systems:

  • Disrupted complex IV assembly: Loss of Cox10 function reduces heme a synthesis, preventing proper assembly of cytochrome c oxidase . This disrupts the terminal step of the electron transport chain.

  • Metabolic reprogramming: Cells with Cox10 deficiency upregulate alternative metabolic pathways. In NK cells, Cox10 deficiency led to increased glycolysis, associated with elevated AMP-activated protein kinase (AMPK) and mammalian target of rapamycin (mTOR) activation .

  • Proliferation defects: Cox10-deficient NK cells showed impaired antigen-specific expansion during viral infection, despite normal in vitro and homeostatic proliferation . This indicates a specific metabolic requirement for antigen-driven proliferation.

  • Insufficient compensation: Despite upregulation of glycolysis, the metabolic adaptations in Cox10-deficient cells were insufficient to support antigen-specific expansion, suggesting unique energetic requirements for this process .

The methodology to study these effects includes:

  • Measuring oxygen consumption rate and extracellular acidification rate using respirometry

  • Analyzing mitochondrial membrane potential with potentiometric dyes

  • Quantifying ATP production through luminescence-based assays

  • Assessing metabolic flux through stable isotope tracing and mass spectrometry

  • Monitoring cellular proliferation under different metabolic challenges

What methodological approaches can be used to study Cox10's role in antifungal resistance?

To investigate potential connections between Cox10 and antifungal resistance in A. fumigatus, researchers can employ several approaches:

  • Comparative genomics:

    • Sequence cox10 from resistant and susceptible strains

    • Identify polymorphisms that correlate with resistance phenotypes

    • Map variations onto protein structure to predict functional consequences

    • Analyze co-evolving genes within the three distinct A. fumigatus populations

  • Functional genomics:

    • Generate Cox10 knockout, knockdown, or overexpression strains

    • Test antifungal susceptibility using standardized protocols

    • Measure growth rates and fitness under antifungal stress

    • Perform complementation with wild-type or variant cox10 alleles

  • Metabolic profiling:

    • Compare metabolic signatures of resistant vs. susceptible strains

    • Analyze changes in respiratory metabolism upon antifungal exposure

    • Measure mitochondrial function in resistant isolates

    • Quantify heme a content and complex IV activity in resistant strains

  • Transcriptomic analysis:

    • Analyze cox10 expression in response to antifungal treatment

    • Identify co-regulated genes in resistant isolates

    • Perform differential expression analysis across resistant populations

    • Map transcriptional networks related to respiratory chain function

  • Biochemical approaches:

    • Purify Cox10 from resistant and susceptible strains

    • Compare enzymatic properties and inhibition patterns

    • Assess structural differences using protein biophysical techniques

    • Investigate protein-protein interactions in the presence of antifungals

These multidisciplinary approaches can provide comprehensive insights into the potential role of Cox10 in antifungal resistance mechanisms.

How can researchers analyze the integration of Cox10 in complex IV assembly?

Analyzing Cox10's role in complex IV assembly requires sophisticated methodological approaches:

  • Blue Native PAGE:

    • Solubilize mitochondria with mild detergents (digitonin or DDM)

    • Separate native complexes on gradient polyacrylamide gels

    • Perform in-gel activity assays for complex IV

    • Conduct western blotting to identify subcomplexes and assembly intermediates

    • Compare assembly patterns between wild-type and Cox10-deficient samples

  • Pulse-chase analysis:

    • Label newly synthesized proteins with radioactive amino acids

    • Chase with non-radioactive media for various time periods

    • Immunoprecipitate complex IV subunits

    • Analyze the kinetics of labeled protein incorporation into the mature complex

    • Compare assembly rates in the presence and absence of functional Cox10

  • Proteomic approaches:

    • Perform quantitative proteomics of mitochondrial fractions

    • Use SILAC or TMT labeling to compare protein abundances

    • Identify assembly factors and interacting partners

    • Map the composition of assembly intermediates

    • Correlate heme a content with assembly progression

  • Structural analysis:

    • Utilize cryo-EM to visualize assembly intermediates

    • Compare structures from wild-type and Cox10-deficient sources

    • Identify structural changes associated with heme a incorporation

    • Map the positioning of heme groups within the complex

  • Genetic complementation:

    • Introduce wild-type or mutant Cox10 variants into deficient cells

    • Measure recovery of complex IV assembly

    • Determine structure-function relationships

    • Test orthologs from different species for functional conservation

These approaches provide complementary information about Cox10's role in the complex assembly process.

What protein engineering approaches can be used to study Cox10 structure-function relationships?

Several protein engineering strategies can elucidate Cox10 structure-function relationships:

  • Site-directed mutagenesis:

    • Identify conserved residues through sequence alignment

    • Generate point mutations in catalytic sites

    • Create mutations in membrane-spanning regions

    • Modify residues predicted to interact with substrates

    • Assess the impact on enzymatic activity and protein stability

  • Domain swapping:

    • Exchange domains between Cox10 homologs from different species

    • Create chimeric proteins to map functional regions

    • Swap transmembrane domains to assess membrane localization requirements

    • Exchange substrate binding regions to alter specificity

  • Deletion analysis:

    • Generate systematic deletions of protein segments

    • Identify minimal functional domains

    • Map regions essential for protein-protein interactions

    • Determine membrane topology requirements

  • Protein tagging strategies:

    • Introduce fluorescent protein fusions for localization studies

    • Add affinity tags for purification while preserving function

    • Create split-protein reporters to monitor interaction dynamics

    • Develop biosensors based on Cox10 conformational changes

  • Directed evolution:

    • Generate libraries of Cox10 variants

    • Select for enhanced activity or stability

    • Identify mutations conferring novel substrate specificity

    • Develop variants with improved expression or solubility

The methodological implementation would involve:

  • Expression of engineered variants in appropriate cellular contexts

  • Biochemical characterization of purified variants

  • Functional complementation assays in Cox10-deficient systems

  • Structural analysis of successful variants

How does recombinant expression system choice affect Cox10 functionality?

The expression system significantly impacts recombinant Cox10 functionality:

Expression SystemAdvantagesLimitationsImpact on Cox10 Functionality
Yeast (CSB-YP687239NGS1) - Eukaryotic post-translational modifications
- Effective membrane protein expression
- Similar cellular environment to N. fumigata
- Lower yields
- More complex cultivation
Most likely to maintain native-like folding and functional properties
E. coli (CSB-EP687239NGS1) - High protein yields
- Simple cultivation
- Well-established protocols
- Lacks eukaryotic modifications
- Challenges with membrane protein folding
May have reduced enzymatic activity but useful for structural studies
E. coli with Biotinylation (CSB-EP687239NGS1-B) - Site-specific biotinylation
- Enhanced detection and immobilization
- Same limitations as standard E. coli expressionFacilitates interaction studies with potential impact on activity
Baculovirus (CSB-BP687239NGS1) - Advanced eukaryotic modifications
- Good for membrane proteins
- More complex production
- Moderate yields
Good balance between yield and functional properties
Mammalian cell (CSB-MP687239NGS1) - Most authentic modifications
- Native-like membrane environment
- Lowest yields
- Most complex system
Highest likelihood of preserving native functionality

Methodological validation approaches include:

  • Compare enzymatic activities of Cox10 from different expression systems

  • Assess complex IV rescue efficiency in complementation assays

  • Evaluate protein stability and folding through biophysical techniques

  • Measure substrate binding affinities across different preparations

  • Determine post-translational modification profiles and their impact on function

The optimal expression system should be selected based on the specific research application, with trade-offs between yield, ease of production, and functional authenticity considered carefully.

How can researchers study the role of Cox10 in different A. fumigatus populations?

To investigate Cox10's function across different A. fumigatus populations:

  • Comparative genomic analysis:

    • Sequence cox10 from representatives of all three A. fumigatus populations

    • Identify population-specific polymorphisms or structural variations

    • Map variations onto protein structural models

    • Analyze selection pressures on cox10 across populations

    • Examine neighboring genes for evidence of co-evolution

  • Transcriptomic profiling:

    • Compare cox10 expression levels across populations

    • Identify population-specific regulation patterns

    • Analyze co-expression networks to detect functional associations

    • Determine condition-specific expression differences

    • Correlate expression with metabolic adaptations

  • Phenotypic characterization:

    • Measure growth rates under different carbon sources

    • Assess respiratory capacity across populations

    • Determine susceptibility to oxidative stress

    • Evaluate virulence in infection models

    • Test antifungal sensitivity profiles

  • Genetic manipulation:

    • Generate cox10 knockouts in strains from each population

    • Perform cross-complementation with cox10 alleles from different populations

    • Create reporter strains to monitor cox10 expression

    • Introduce specific mutations to test functional hypotheses

    • Analyze the phenotypic consequences of gene editing

  • Metabolic profiling:

    • Compare heme biosynthesis pathways across populations

    • Analyze respiratory chain composition and efficiency

    • Measure oxidative phosphorylation capacity

    • Profile metabolic adaptations to environmental stresses

    • Identify population-specific metabolic signatures

These approaches would help understand how Cox10 function might contribute to the ecological specialization observed across the three primary A. fumigatus populations .

What are the future research directions for Cox10 in fungal pathogenesis?

Several promising research directions can advance our understanding of Cox10 in fungal pathogenesis:

  • Pathogen-host interaction studies:

    • Investigate Cox10's role in adaptation to host environments

    • Analyze how host immune factors affect Cox10 function

    • Determine if Cox10 contributes to immune evasion mechanisms

    • Explore metabolic adaptation during infection progression

    • Assess Cox10's contribution to virulence in animal models

  • Drug development opportunities:

    • Evaluate Cox10 as a potential antifungal target

    • Develop specific inhibitors of fungal Cox10

    • Screen for compounds that selectively affect fungal but not human Cox10

    • Test combination therapies targeting respiratory metabolism

    • Analyze resistance development mechanisms to Cox10 inhibitors

  • Environmental adaptation mechanisms:

    • Study Cox10's role in adaptation to different ecological niches

    • Investigate how environmental stressors affect Cox10 function

    • Determine if Cox10 variants contribute to population-specific adaptations

    • Explore the relationship between metabolic flexibility and pathogenicity

    • Analyze Cox10's role in biofilm formation

  • Comparative studies across fungal pathogens:

    • Compare Cox10 function across different pathogenic fungi

    • Identify conserved and divergent features

    • Determine if common mechanisms exist for respiratory adaptation

    • Explore evolutionary patterns across fungal lineages

    • Develop broad-spectrum approaches targeting conserved functions

  • Integration with systems biology approaches:

    • Incorporate Cox10 function into genome-scale metabolic models

    • Predict metabolic vulnerabilities using in silico approaches

    • Apply network analysis to understand Cox10's position in cellular systems

    • Develop predictive models of respiratory adaptation during infection

    • Integrate multi-omics data to construct comprehensive functional models

These research directions could significantly advance our understanding of how mitochondrial metabolism contributes to fungal pathogenesis and potentially reveal new therapeutic opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.