Recombinant Neosartorya fumigata Rhomboid protein 2 (rbd2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Hypoxia and Virulence

Research highlights rbd2’s role in fungal adaptation to low-oxygen environments and pathogenicity:

  • Hypoxia Sensing:

    • Deletion of rbd2 (annotated as rbdA in genomic studies) abolishes hypoxic growth and dysregulates SrbA-dependent genes .

    • Phenocopies srbA deletion, causing hypersensitivity to CoCl₂, fluconazole, and iron starvation .

  • Virulence Mechanisms:

    • Δrbd2 mutants exhibit attenuated virulence in murine models due to impaired phagocyte evasion and reduced Th1/Th17 immune responses .

    • Required for SrbA cleavage, releasing its N-terminal transcription factor domain to activate hypoxia-responsive genes .

  • Interaction Network:

    • Acts upstream of SrbA in a proteolytic cascade involving Dsc complex proteins (DscA-E) .

    • Functional rescue of Δrbd2 requires N-terminal SrbA (including HLH domain), confirming their pathway linkage .

Comparative Analysis of Rhomboid Proteases in A. fumigatus

Four putative rhomboid proteases are encoded in A. fumigatus:

Gene IDNameFunctionUniProt ID
Afu6g12750rbd2SrbA cleavage, hypoxia adaptation, virulenceQ4WLP9
Afu6g12610Uncharacterized
Afu2g16490Uncharacterized
Afu1g09150Uncharacterized

rbd2 shows closest homology to Saccharomyces cerevisiae RBD2 and Schizosaccharomyces pombe RBD2 .

Research Implications and Applications

  • Therapeutic Targets: rbd2’s essentiality in virulence highlights its potential as an antifungal drug target .

  • Hypoxia Signaling: Mechanistic insights into SrbA activation could inform treatments for aspergillosis in immunocompromised patients .

  • Biotechnological Use: Recombinant rbd2 serves as a tool for studying rhomboid protease structure-function relationships .

Limitations and Future Directions

  • Nomenclature Conflicts: Discrepancies exist between rbd2 (product nomenclature) and rbdA (genomic annotation) .

  • Uncharacterized Paralogs: Three other rhomboid proteases in A. fumigatus remain unstudied, warranting further exploration .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rbd2; AFUA_6G12750; Rhomboid protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-272
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
rbd2
Target Protein Sequence
MAIPAALPPLPFNPTRVRSYMLRLPLFTRLVLLVILAFWLLELQTIWSVVQWGSLTPNEI GIGSMYRLNTYPFIHVGFFHAFVNLLALTPLLERFEAEHGTLTAVALFIGPLSTFPAGIY ILVEKFILRSNTAVVGASVWIFLLLGSEAIKTFKSNPYFSLGTTKIPTWTSPLFACALVS IFVPNTSFLGHLSAIIIGYLLGLGYLKVFVPPEKILRWIEGKLNLLGRLPHYVSVDQKTY GRYGVLPTATAAVGGERPTPLSYLGTNQRLGP
Uniprot No.

Target Background

Function

Probable serine protease.

Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Golgi apparatus, cis-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is Neosartorya fumigata Rhomboid protein 2 (rbd2)?

Rhomboid protein 2 (rbd2) is one of four putative rhomboid family proteases found in Neosartorya fumigata (Aspergillus fumigatus). The protein is encoded by the gene AFUA_6G12750 (also known as rbd2) and consists of 272 amino acids . Rhomboid family proteases are intramembrane serine proteases present in nearly all sequenced genomes across archaea, bacteria, and eukaryotes, functioning in diverse processes including membrane fusion, apoptosis, and stem cell differentiation .

The protein has been cataloged in UniProt with ID Q4WLP9 and is also known by the synonyms "rbd2" and "Rhomboid protein 2" . Unlike the better-characterized RbdA (another rhomboid family protein in A. fumigatus), rbd2's specific functional role requires further investigation.

How does rbd2 differ from other rhomboid family proteins in Aspergillus fumigatus?

Aspergillus fumigatus contains four putative rhomboid family members: Afu6g12750 (rbd2), Afu6g12610, Afu2g16490, and Afu1g09150 . Of these, RbdA (not to be confused with rbd2) has been most extensively characterized and plays a crucial role in hypoxia adaptation and fungal virulence through its involvement in the SrbA signaling pathway .

What expression systems are optimal for producing recombinant rbd2?

Recombinant expression of Neosartorya fumigata rbd2 has been successfully achieved in Escherichia coli systems . When expressing rbd2, consider the following methodological approaches:

  • Vector selection: Expression vectors containing a His-tag sequence at the N-terminal of the protein allow for efficient purification using affinity chromatography .

  • E. coli strain optimization: BL21(DE3) or similar strains designed for protein expression are recommended due to their reduced protease activity.

  • Induction parameters: Optimize IPTG concentration, temperature, and induction time to maximize protein yield while maintaining proper folding.

  • Membrane protein considerations: As a predicted membrane protein, rbd2 may form inclusion bodies. Consider using detergents or membrane-mimicking environments during purification and refolding.

For researchers requiring native-like post-translational modifications, eukaryotic expression systems such as Pichia pastoris or insect cells might provide alternatives, though these approaches remain to be validated for rbd2 specifically.

What are the recommended storage and handling procedures for recombinant rbd2?

Proper storage and handling of recombinant rbd2 is critical for maintaining protein activity. Based on established protocols for similar proteins:

  • Storage conditions:

    • Store lyophilized protein at -20°C to -80°C upon receipt

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended: 50%) for long-term storage

  • Buffer considerations:

    • The protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • For functional assays, buffer optimization may be necessary depending on the specific application

Storage ConditionRecommended TemperatureMaximum Storage Duration
Lyophilized powder-20°C to -80°CLong-term storage
Reconstituted without glycerol4°CUp to one week
Reconstituted with glycerol (50%)-20°C to -80°CLong-term storage

What analytical methods are appropriate for verifying rbd2 integrity and purity?

To verify the integrity and purity of recombinant rbd2:

  • SDS-PAGE analysis: A standard method to confirm protein molecular weight (approximately 30 kDa plus any fusion tags) and assess purity, which should exceed 90% .

  • Western blotting: Using anti-His antibodies (for His-tagged constructs) or specific anti-rbd2 antibodies if available.

  • Mass spectrometry: For precise molecular weight determination and potential identification of post-translational modifications.

  • Circular dichroism (CD): To assess secondary structure, particularly important for membrane proteins to verify proper folding.

  • Activity assays: While specific substrates for rbd2 have not been definitively identified, proteolytic activity could be assessed using fluorogenic peptide substrates designed based on predicted cleavage motifs.

What is the current understanding of rbd2's role in Aspergillus fumigatus biology?

  • Potential involvement in stress responses: Rhomboid proteases often function in cellular stress responses, including adaptation to environmental changes .

  • Possible role in protein quality control: Many rhomboid proteases participate in membrane protein degradation pathways.

  • Signaling pathway involvement: By analogy to RbdA, rbd2 might participate in proteolytic activation of signaling molecules, though its specific substrates remain unknown.

The most extensively studied rhomboid protein in A. fumigatus is RbdA, which has been demonstrated to be essential for adaptation to hypoxic conditions and virulence through the SrbA pathway . Whether rbd2 has a complementary, redundant, or entirely distinct function remains an open question requiring further research.

How is rbd2 expression regulated under different environmental conditions?

While specific data on rbd2 regulation is limited, research on related rhomboid proteases suggests several potential regulatory mechanisms:

  • Oxygen-dependent regulation: Given that RbdA is essential for hypoxic growth in A. fumigatus, rbd2 expression might also respond to oxygen levels, potentially through different regulatory pathways .

  • Stress response: Fungal pathogens encounter various stresses within the host environment. Expression studies under conditions mimicking these stresses (oxidative stress, temperature shifts, pH changes) could reveal condition-specific regulation.

  • Developmental regulation: Expression may vary throughout the fungal life cycle (conidia, germination, hyphal growth).

An experimental approach to investigate rbd2 regulation would include:

  • qRT-PCR analysis of rbd2 expression under various stress conditions

  • Promoter analysis to identify potential transcription factor binding sites

  • Reporter gene assays using the rbd2 promoter to monitor expression in vivo

How does rbd2 potentially contribute to Aspergillus fumigatus pathogenesis?

The contribution of rbd2 to A. fumigatus pathogenesis remains speculative, but several hypotheses can be proposed based on the known functions of rhomboid proteases and the critical role of RbdA in virulence:

  • Potential involvement in hypoxia adaptation: A. fumigatus encounters hypoxic microenvironments during invasive infection. If rbd2 contributes to hypoxia adaptation, it could impact virulence .

  • Possible role in cell wall integrity: Rhomboid proteases can process proteins involved in cell wall maintenance, which is crucial for fungal pathogenesis and antifungal resistance.

  • Immune evasion mechanisms: Proteolytic processing of surface proteins could potentially modify host-pathogen interactions.

Based on studies with RbdA, deletion of rhomboid proteases in A. fumigatus can result in:

  • Inability to grow under hypoxic conditions

  • Abnormal hyphal morphology

  • Increased sensitivity to cell wall-targeting agents

  • Attenuated virulence in animal models

Whether rbd2 deletion would produce similar phenotypes remains to be determined through targeted gene knockout studies.

What experimental strategies can help determine rbd2 substrates and interacting partners?

Identifying substrates and interacting partners of rbd2 requires sophisticated experimental approaches:

  • Proteomic approaches:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) comparing wild-type and rbd2-deletion strains

    • Proximity labeling methods (BioID, APEX) with rbd2 as the bait protein

    • Co-immunoprecipitation followed by mass spectrometry

  • Genetic screening:

    • Synthetic genetic array analysis to identify genetic interactions

    • Suppressor screens of rbd2 mutant phenotypes

  • Biochemical approaches:

    • In vitro cleavage assays using recombinant rbd2 and candidate substrates

    • Peptide library screening to determine cleavage site preferences

  • Structural biology:

    • X-ray crystallography or cryo-EM to determine three-dimensional structure

    • Molecular docking to predict substrate binding

When designing these experiments, researchers should consider the membrane-embedded nature of rhomboid proteases, which presents technical challenges for traditional protein-protein interaction studies.

How might the function of rbd2 differ from the well-characterized RbdA in Aspergillus fumigatus?

Research on RbdA provides a framework for understanding potential functional differences between rhomboid proteases in A. fumigatus:

  • Hypoxia adaptation: RbdA is essential for growth under hypoxic conditions through its role in SrbA activation . Rbd2 might:

    • Function in parallel pathways responding to different oxygen thresholds

    • Process different substrates involved in alternative adaptation mechanisms

    • Have activity under different environmental conditions

  • Substrate specificity: Different rhomboid proteases typically recognize distinct sequence motifs or structural features in their substrates.

  • Subcellular localization: Rhomboid proteases can localize to different cellular compartments (plasma membrane, ER, mitochondria, Golgi), suggesting distinct functions.

  • Phenotypic consequences of deletion: While RbdA deletion results in avirulence and inability to grow under hypoxia , rbd2 deletion phenotypes remain to be characterized. Comparative phenotypic analysis of single and double deletion mutants would provide insights into functional overlap or distinctness.

An experimental design to distinguish rbd2 and RbdA functions might include:

  • Creation of single and double deletion mutants

  • Cross-complementation experiments

  • Comparative transcriptomic and proteomic analysis of mutant strains

  • Substrate identification for each protease

What methodological challenges exist when studying membrane proteases like rbd2?

Membrane-embedded proteases present unique experimental challenges:

  • Expression and purification difficulties:

    • Aggregation and inclusion body formation during recombinant expression

    • Requirement for detergents or membrane mimetics to maintain native structure

    • Potential toxicity to expression hosts

  • Assay development complexities:

    • Need for membrane or detergent environments in activity assays

    • Difficulty distinguishing direct from indirect effects in cellular systems

    • Substrate accessibility issues in reconstituted systems

  • Structural analysis limitations:

    • Challenges in obtaining high-resolution structures of membrane proteins

    • Conformational dynamics that may be lost in detergent-solubilized preparations

  • In vivo analysis considerations:

    • Potential pleiotropy of deletion phenotypes

    • Functional redundancy with other proteases

    • Difficulty in distinguishing primary from secondary effects

Strategies to overcome these challenges include:

  • Use of specialized membrane protein expression systems

  • Nanodiscs or lipid cubic phase for maintaining native-like environments

  • Advanced imaging techniques like super-resolution microscopy

  • Computational approaches to predict structure and function

How does rbd2 from Neosartorya fumigata compare to rhomboid proteases in other pathogenic fungi?

Comparative analysis of rhomboid proteases across pathogenic fungi reveals:

  • Conservation and divergence:

    • Rhomboid proteases are conserved across fungal species, suggesting essential functions

    • Sequence divergence may reflect adaptation to specific ecological niches

  • Pathogenicity correlation:

    • In N. udagawae, a species closely related to N. fumigata that causes more chronic infections, rhomboid proteases may contribute to differences in disease progression

    • Comparative phenotypic analysis between species could reveal evolutionarily conserved functions

  • Host adaptation mechanisms:

    • Different fungal pathogens encounter distinct host environments

    • Rhomboid proteases may have evolved species-specific functions in host adaptation

Research approaches for comparative analysis:

  • Phylogenetic analysis of rhomboid proteases across fungal species

  • Heterologous expression studies with rhomboid proteases from different species

  • Cross-species complementation experiments

What experimental design would best evaluate the potential of rbd2 as an antifungal target?

Evaluating rbd2 as a potential antifungal target requires a systematic approach:

  • Target validation:

    • Generate conditional mutants to verify essentiality under relevant conditions

    • Determine phenotypic consequences of rbd2 inhibition

    • Assess impacts on virulence in animal models

  • Assay development:

    • Design high-throughput screening assays for inhibitor identification

    • Develop specific activity assays using fluorogenic or chromogenic substrates

    • Establish cellular assays to monitor rbd2 function

  • Inhibitor development strategy:

    • Structure-based design if structural information becomes available

    • Fragment-based screening approaches

    • Peptidomimetic inhibitors based on substrate recognition motifs

  • Selectivity considerations:

    • Assess conservation between fungal and human rhomboid proteases

    • Design counter-screens against human homologs

    • Evaluate off-target effects in mammalian cell systems

A randomized block design (RBD) experimental approach would be appropriate for inhibitor testing, where experimental material is grouped into homogeneous blocks to control for variables like batch effects .

Experimental PhaseKey MethodsExpected Outcomes
Target validationGene deletion, conditional expressionPhenotypic characterization, virulence assessment
Assay developmentBiochemical assays, cell-based assaysRobust screening platform
Inhibitor screeningHigh-throughput screening, structure-based designLead compound identification
Selectivity profilingCounter-screens, toxicity assessmentSafety profile determination

This comprehensive research pipeline would systematically evaluate rbd2's potential as an antifungal target while addressing the experimental challenges inherent to membrane protein research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.