Recombinant Neosartorya fumigata Solute carrier family 25 member 38 homolog (AFUB_069300)

Shipped with Ice Packs
In Stock

Description

Overview of the Compound

Recombinant Neosartorya fumigata Solute Carrier Family 25 Member 38 Homolog (AFUB_069300) is a bioengineered protein derived from the AFUB_069300 gene in Neosartorya fumigata (a strain of Aspergillus fumigatus). This protein belongs to the mitochondrial carrier protein family (SLC25) and is homologous to human SLC25A38, a transporter involved in glycine import into mitochondria for heme biosynthesis . The recombinant form is produced in E. coli and is used in research to study fungal metabolism, mitochondrial transport, and pathogenic mechanisms .

Product Variants and Suppliers

SupplierHostPurityKey FeaturesSource
Creative BioMartE. coli≥90%Full-length (1–320 aa), His-tagged, lyophilized
MyBioSourceE. coli≥85%Partial sequence, customizable tags
CBM15E. coliN/A50 µg vials, Tris-based buffer

Experimental Uses

  • Western Blotting: Detect mitochondrial transport proteins in A. fumigatus samples .

  • Functional Studies: Investigate glycine transport or heme biosynthesis in fungal pathogens .

  • Structural Analysis: Crystallization or interaction studies with mitochondrial substrates .

Comparative Analysis with Human SLC25A38

FeatureHuman SLC25A38AFUB_069300 (Homolog)Source
Primary RoleMitochondrial glycine transporterPutative mitochondrial carrier
Disease AssociationCongenital sideroblastic anemia (CSA)Unexplored
Key MutationsMissense variants (e.g., p.Gln56Lys)No reported mutations

Potential Roles in A. fumigatus

  • Heme Biosynthesis: Similar to human SLC25A38, AFUB_069300 may facilitate glycine import for porphyrin synthesis, critical for fungal survival and pathogenicity .

  • Mitochondrial Redox Balance: Hypothetical involvement in managing reactive oxygen species (ROS), as seen in human cells with SLC25A38 dysfunction .

Challenges and Future Directions

While recombinant AFUB_069300 is commercially available, direct experimental validation of its function remains lacking. Key gaps include:

  1. Functional Characterization: No studies confirm its substrate specificity or transport activity.

  2. Pathogenic Relevance: No data link AFUB_069300 to A. fumigatus virulence or antifungal resistance .

Future research should prioritize:

  • CRISPR/Cas9 Knockouts: Assess phenotypic effects in A. fumigatus.

  • Biochemical Assays: Measure glycine transport kinetics in reconstituted membranes.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requirements. Please indicate your preference in order remarks, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For proper reconstitution, centrifuge the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms exhibit a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Repeated freeze-thaw cycles should be minimized.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specifications.
Synonyms
AFUB_069300; Mitochondrial glycine transporter; Solute carrier family 25 member 38 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus)
Target Names
AFUB_069300
Target Protein Sequence
MLYSCLASKTTFHFAAGLCSGLTSSILLQPADLLKTRVQQSQKTASLLPTIKTILSSPHP IRGLWRGTLPSALRTGFGSALYFTSLNALRQGLAQTEAAMAIAASSSDGKSRTSSSALPK LSNWGNLATGAVARTAAGFVMMPVTVLKVRYESDYYAYRSLYSAGRDIVRTEGVRGLFSG FGATAARDAPYAGLYVLFYEQLKRRLALVASSEQSEQPLKSTSSSSINFVSGGLAAGLAT AITNPFDAVKTRLQLMPGKYGNMIRAVRLMIREDGVRSLFGGLGLRITRKALSSALAWTV YEELILRAEARWAEKDKIDL
Uniprot No.

Target Background

Function
This mitochondrial glycine transporter facilitates the import of glycine into the mitochondrial matrix. It plays a crucial role in providing glycine for the initial enzymatic step in heme biosynthesis, the condensation of glycine with succinyl-CoA to generate 5-aminolevulinate (ALA) within the mitochondrial matrix.
Protein Families
Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Neosartorya fumigata Solute Carrier Family 25 Member 38 Homolog?

Neosartorya fumigata Solute carrier family 25 member 38 homolog (AFUB_069300) is a mitochondrial membrane protein characterized as a glycine transporter . The protein consists of 320 amino acids and belongs to the solute carrier family 25, a group of proteins responsible for transporting various molecules across mitochondrial membranes. The protein has UniProt ID B0Y4J4 and is encoded by the AFUB_069300 gene in Neosartorya fumigata (also known as Aspergillus fumigatus) . As a mitochondrial carrier protein, it likely plays an essential role in fungal metabolism, particularly in glycine transport into mitochondria, which is crucial for various metabolic pathways.

How is the recombinant protein produced and prepared for research use?

The recombinant full-length Neosartorya fumigata Solute carrier family 25 member 38 homolog protein is typically produced using E. coli expression systems with an N-terminal His-tag for purification purposes . The expression process involves:

  • Cloning the full coding sequence (amino acids 1-320) into a suitable expression vector

  • Transforming the construct into E. coli expression host cells

  • Inducing protein expression under optimized conditions

  • Cell lysis and protein extraction

  • Purification via His-tag affinity chromatography

  • Lyophilization to create a stable powder form

For research applications, the lyophilized protein is reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with addition of 5-50% glycerol (typically 50%) as a cryoprotectant for long-term storage at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided to maintain protein integrity and functionality.

How can I assess the functional activity of recombinant AFUB_069300 protein?

Assessing the functional activity of the recombinant Neosartorya fumigata Solute carrier family 25 member 38 homolog requires specialized transport assays since it functions as a mitochondrial glycine transporter. A methodological approach includes:

  • Liposome reconstitution assay:

    • Purify the recombinant protein to >95% homogeneity using additional chromatography steps beyond initial His-tag purification

    • Reconstitute the protein into liposomes containing appropriate phospholipids

    • Load liposomes with internal substrate or buffer

    • Measure glycine transport by monitoring substrate accumulation inside liposomes over time

  • Cell-based transport assays:

    • Express the protein in transport-deficient cell lines

    • Measure glycine uptake using radiolabeled glycine or fluorescent glycine analogs

    • Compare transport rates with and without specific inhibitors

  • Biophysical characterization:

    • Analyze protein stability and folding using circular dichroism

    • Assess substrate binding using isothermal titration calorimetry or microscale thermophoresis

These functional assays should include appropriate positive and negative controls, and researchers should be aware that the His-tag may influence transport activity, potentially necessitating tag removal for certain applications.

What structural features define the Solute Carrier Family 25 transporters, and how might they apply to AFUB_069300?

Solute Carrier Family 25 (SLC25) transporters share several structural characteristics that likely apply to AFUB_069300:

Structural FeatureDescriptionRelevance to AFUB_069300
Three-fold pseudo-symmetryContains three tandemly repeated ~100 aa domainsExamination of the 320aa sequence reveals potential repeating motifs
Six transmembrane helicesArranged in three pairs spanning the inner mitochondrial membraneHydrophobicity analysis suggests similar arrangement
Conserved PX[D/E]XX[K/R] motifsPresent in each of the three domains, crucial for substrate translocationSequence analysis indicates presence of similar motifs
Substrate-binding sitesLocated at the center of the cavity formed by the six helicesLikely location for glycine binding
Gate mechanismAlternating access between cytosolic and matrix sidesExpected functional mechanism for AFUB_069300

To experimentally validate these structural features in AFUB_069300:

  • Perform computational structure prediction using homology modeling based on known SLC25 family structures

  • Apply site-directed mutagenesis to confirm the importance of predicted key residues

  • Attempt crystallization or cryo-EM studies to determine the three-dimensional structure

  • Use molecular dynamics simulations to predict substrate binding and transport mechanisms

The glycine transport function suggests this protein may share structural similarities with other mitochondrial amino acid transporters within the SLC25 family.

How does the fungal AFUB_069300 differ from mammalian SLC25 family transporters?

Understanding the differences between fungal AFUB_069300 and mammalian SLC25 transporters is crucial for potential therapeutic targeting:

FeatureFungal AFUB_069300Mammalian SLC25 HomologsAnalytical Method
Sequence homologyReference sequenceTypically 30-60% identity depending on specific mammalian homologBLAST analysis against human proteome
Substrate specificityPrimarily glycine transportVarious specificities including glycine, but often broader substrate rangeComparative transport assays with different substrates
Inhibitor sensitivityMay have unique sensitivity profilesWell-characterized inhibition patternsPharmacological profiling with transport inhibitors
Post-translational modificationsFewer glycosylation sitesOften heavily glycosylatedMass spectrometry analysis
Protein-protein interactionsFungal-specific interaction partnersTissue-specific mammalian interactorsCo-immunoprecipitation studies

To experimentally characterize these differences:

  • Perform detailed sequence and structural alignments between AFUB_069300 and human SLC25 family members

  • Compare transport kinetics (Km, Vmax) for various substrates

  • Conduct inhibitor screening to identify compounds that selectively target the fungal transporter

  • Analyze the protein interactome in fungal vs. mammalian systems

These differences could potentially be exploited for developing antifungal therapies that selectively target the fungal transporter without affecting human homologs.

What are the optimal storage and handling conditions for maintaining protein activity?

Proper storage and handling of recombinant Neosartorya fumigata Solute carrier family 25 member 38 homolog is critical for maintaining its structural integrity and functional activity:

Storage ParameterRecommended ConditionRationale
Long-term storage-20°C/-80°C in aliquots with 50% glycerolPrevents protein degradation and maintains stability
Working stock4°C for up to one weekMinimizes freeze-thaw damage while maintaining accessibility
Buffer compositionTris/PBS-based buffer, pH 8.0 with 6% TrehaloseProvides optimal stability and prevents aggregation
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLEnsures proper solubilization without denaturing agents
Freeze-thaw cyclesAvoid repeated cyclesPrevents protein denaturation and activity loss

For optimal handling:

  • Centrifuge vials briefly before opening to collect contents at the bottom

  • Prepare smaller working aliquots immediately after reconstitution

  • Use low-protein-binding tubes for storage

  • Monitor protein stability with routine activity assays after storage

  • Consider adding protease inhibitors for sensitive applications

These storage and handling protocols are essential to ensure experimental reproducibility and reliable results in downstream applications.

What experimental controls should be included when using this protein in research?

When working with recombinant Neosartorya fumigata Solute carrier family 25 member 38 homolog, incorporating appropriate experimental controls is essential:

Control TypeDescriptionPurpose
Negative protein controlHeat-denatured AFUB_069300Confirms observed effects require functional protein
Positive transport controlWell-characterized SLC25 family memberValidates assay system performance
Tag-only controlProtein expressing only the His-tagEnsures effects aren't due to the tag
Buffer controlStorage buffer without proteinControls for buffer component effects
Species specificity controlHuman SLC25 homologDistinguishes fungal-specific from conserved activities
Substrate specificity controlNon-transported molecule similar to glycineConfirms transport specificity

Additionally, researchers should include:

  • Concentration-dependent controls (dose-response)

  • Time-course experiments to establish kinetics

  • Inhibitor controls to confirm mechanism of action

  • Expression verification through Western blotting before functional studies

  • Batch-to-batch consistency controls when using multiple protein preparations

These controls help distinguish specific protein effects from artifacts and ensure experimental rigor and reproducibility.

How can this protein be used in studying fungal metabolism and potential antifungal targets?

The recombinant Neosartorya fumigata Solute carrier family 25 member 38 homolog offers several methodological approaches for investigating fungal metabolism and identifying potential antifungal targets:

  • Metabolic flux analysis:

    • Incorporate isotope-labeled glycine in fungal cultures

    • Monitor metabolite distributions with and without AFUB_069300 inhibition

    • Quantify changes in downstream metabolic pathways

  • Genetic manipulation studies:

    • Create knockout or knockdown strains of AFUB_069300 in Neosartorya fumigata

    • Assess phenotypic changes in growth, morphology, and virulence

    • Complement with recombinant protein to confirm specificity

  • Drug discovery applications:

    • Develop high-throughput screening assays using the recombinant protein

    • Screen compound libraries for selective inhibitors

    • Validate hits in fungal growth and infection models

  • Structure-based drug design:

    • Use the recombinant protein for structural studies (X-ray crystallography, cryo-EM)

    • Employ in silico docking to identify potential binding pockets

    • Design rational inhibitors based on structural information

  • Pathogenesis studies:

    • Examine the role of AFUB_069300 in host-pathogen interactions

    • Investigate its expression during different infection stages

    • Assess its contribution to fungal survival in various host environments

Given the importance of Aspergillus fumigatus as a major pathogen causing invasive aspergillosis with 80-90% mortality rates in leukemia patients , targeting metabolic transporters like AFUB_069300 could represent a novel therapeutic approach, especially as this pathway may be essential for fungal survival within the host.

What are common challenges in working with recombinant membrane proteins like AFUB_069300?

Membrane proteins present unique challenges in recombinant expression and handling:

ChallengeCauseRecommended Solution
Low expression yieldToxicity to host cells, protein aggregationOptimize expression conditions (temperature, induction time); test different E. coli strains
Protein misfoldingImproper membrane insertion in E. coliConsider eukaryotic expression systems; add solubilizing agents
Loss of activity during purificationDetergent-induced denaturationScreen multiple detergents at minimal concentrations; use stabilizing additives
Poor solubility after reconstitutionHydrophobic aggregationAdd non-ionic detergents at concentrations below CMC; optimize buffer composition
Inconsistent functional assaysHeterogeneous protein populationsImplement additional purification steps; verify protein homogeneity by size exclusion chromatography

When troubleshooting:

  • Verify protein integrity by SDS-PAGE and Western blotting before functional studies

  • Assess protein homogeneity through dynamic light scattering

  • Monitor secondary structure using circular dichroism to confirm proper folding

  • Test multiple reconstitution protocols to identify optimal conditions

  • Consider nanodiscs or other membrane mimetics for stabilization

These approaches can help overcome the inherent difficulties in working with recombinant membrane transporters like AFUB_069300.

How can I verify the authenticity and purity of the recombinant protein?

Verification of recombinant Neosartorya fumigata Solute carrier family 25 member 38 homolog authenticity and purity requires multiple analytical techniques:

  • SDS-PAGE analysis:

    • Expected molecular weight: ~34-36 kDa (including His-tag)

    • Should show >90% purity with minimal degradation products

    • Silver staining for detecting low-abundance contaminants

  • Western blotting:

    • Primary detection using anti-His antibody

    • Secondary confirmation with specific antibodies against AFUB_069300 (if available)

    • Verify expected migration pattern and absence of truncated forms

  • Mass spectrometry:

    • Peptide mass fingerprinting to confirm identity

    • LC-MS/MS for sequence confirmation and post-translational modification analysis

    • Intact protein mass to verify full-length expression

  • Functional verification:

    • Transport activity assays using proteoliposomes

    • Binding studies with known substrates or inhibitors

    • Comparison with predicted activity based on sequence homology

  • Biophysical characterization:

    • Circular dichroism to verify secondary structure elements

    • Dynamic light scattering to assess homogeneity and aggregation state

    • Thermal shift assays to evaluate protein stability

Researchers should aim for >95% purity for most applications, with >98% recommended for structural studies and detailed biochemical characterization.

How can computational approaches enhance research on AFUB_069300?

Computational methods offer powerful tools for studying Neosartorya fumigata Solute carrier family 25 member 38 homolog:

Computational ApproachApplication to AFUB_069300Expected Outcome
Homology modelingBuild 3D structure using known SLC25 structures as templatesPredicted tertiary structure with identified functional domains
Molecular dynamics simulationsSimulate protein behavior in membrane environmentTransport mechanism insights, conformational changes
Virtual screeningDock compound libraries against predicted binding sitesIdentification of potential inhibitor candidates
Sequence-based analysisCompare with homologs across speciesEvolutionary insights, conservation patterns
Systems biology modelingIntegrate into metabolic network modelsPredictions of metabolic impact when inhibited

A methodological workflow might include:

  • Multiple sequence alignment of AFUB_069300 with characterized SLC25 family members

  • Construction of homology models using AlphaFold2 or similar tools

  • Refinement of models through molecular dynamics simulations in a lipid bilayer

  • Identification of potential substrate binding sites and gating residues

  • Virtual screening campaigns to identify potential selective inhibitors

  • Experimental validation of computational predictions

These computational approaches can guide experimental design, help interpret results, and accelerate discovery of inhibitors that might serve as leads for antifungal development.

What insights can AFUB_069300 provide about fungal pathogenesis and host-pathogen interactions?

Investigating AFUB_069300 can yield valuable insights into Neosartorya fumigata pathogenesis:

  • Metabolic adaptation during infection:

    • AFUB_069300 likely facilitates glycine transport, which may be crucial during certain infection stages

    • Comparison of expression levels between saprophytic growth and invasive infection

    • Analysis of metabolic rewiring during adaptation to host environment

  • Potential role in virulence:

    • Creation of knockout strains to assess virulence in animal models

    • Evaluation of growth and survival under various stress conditions

    • Examination of biofilm formation capacity with and without functional AFUB_069300

  • Host immune recognition:

    • Assessment of AFUB_069300 as a potential antigen recognized by host immune system

    • Investigation of antibody responses in patients with different forms of aspergillosis

    • Determination of T-cell epitopes within the protein sequence

  • Therapeutic targeting:

    • Exploitation of structural differences from human homologs for selective inhibition

    • Development of antibodies or small molecules targeting AFUB_069300

    • Evaluation of combination approaches with existing antifungals

Given that invasive aspergillosis has a mortality rate of 80-90% even with treatment and occurs in 10-25% of all leukemia patients , understanding the role of metabolic transporters like AFUB_069300 could provide crucial insights into fungal adaptation mechanisms during infection and potentially reveal new therapeutic approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.