Recombinant Neosartorya fumigata Solute carrier family 25 member 38 homolog (AFUA_4G12340)

Shipped with Ice Packs
In Stock

Description

Nomenclature and Biological Context

AFUA_4G12340 is a gene in Neosartorya fumigata (a species within the Aspergillus genus) encoding a mitochondrial solute carrier. Its recombinant form is produced via genetic engineering, typically in bacterial systems like E. coli. The protein shares functional homology with human SLC25A38, which facilitates glycine transport into mitochondria for heme synthesis .

AttributeDetail
Gene NameAFUA_4G12340
Uniprot IDQ4WQC5
SpeciesNeosartorya fumigata (strain ATCC MYA-4609 / Af293)
FunctionMitochondrial solute transport, inferred from structural homology
Expression SystemE. coli

Production and Purification

The recombinant protein is expressed as a full-length construct (1–320 amino acids) with N-terminal His tags for purification. Key production parameters include:

ParameterSpecification
TagHis-tag
Purity>90% (SDS-PAGE validated)
FormLyophilized powder or liquid (Tris/PBS-based buffer)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles

The amino acid sequence includes conserved motifs typical of mitochondrial carrier proteins, such as transmembrane domains and substrate-binding sites .

Diagnostic and Immunological Tools

  • ELISA Development: Used as an antigen in enzyme-linked immunosorbent assays to detect specific antibodies .

  • Western Blotting: Serves as a positive control for validating antibodies targeting mitochondrial transporters .

Functional Studies

  • Mitochondrial Transport Research: Investigates solute transport mechanisms in fungal metabolism, particularly glycine utilization in heme biosynthesis .

  • Comparative Genomics: Compares transport efficiency with human SLC25A38 to elucidate evolutionary divergence .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your requests whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
AFUA_4G12340; Mitochondrial glycine transporter; Solute carrier family 25 member 38 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
AFUA_4G12340
Target Protein Sequence
MLYSCLASKTTFHFAAGLCSGLTSSILLQPADLLKTRVQQSQKTASLLPTIKTILSSPHP IRGLWRGTLPSALRTGFGSALYFTSLNALRQGLAQTEAAMAIAASSSDGKSRTSSSALPK LSNWGNLATGAVARTAAGFVMMPVTVLKVRYESDYYAYRSLYSAGRDIVRTEGVRGLFSG FGATAARDAPYAGLYVLFYEQLKRRLALVASSEQSEQPLKSTSSSSINFVSGGLAAGLAT AITNPFDAVKTRLQLMPGKYGNMIRAVRLMIREDGVRSLFGGLGLRITRKALSSALAWTV YEELILRAEARWAEKDKIDL
Uniprot No.

Target Background

Function
This mitochondrial glycine transporter facilitates the import of glycine into the mitochondrial matrix. It plays a crucial role in providing glycine for the first enzymatic step in heme biosynthesis, the condensation of glycine with succinyl-CoA to produce 5-aminolevulinate (ALA) in the mitochondrial matrix.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of AFUA_4G12340 in Neosartorya fumigata?

AFUA_4G12340 functions as a mitochondrial carrier protein belonging to the solute carrier family 25. This protein is predicted to facilitate the transport of specific metabolites across the inner mitochondrial membrane, playing a crucial role in mitochondrial function and cellular metabolism in N. fumigata. Current research suggests it may be involved in iron homeostasis similar to other SLC25A38 homologs, potentially transporting glycine or related compounds needed for heme biosynthesis. Functional analysis through gene knockout approaches, similar to those used for other N. fumigata genes, can help elucidate its specific role . When designing knockout experiments, researchers should consider flanking the target gene with appropriate markers to confirm successful gene deletion, as demonstrated in other N. fumigata studies .

What genomic and structural features characterize AFUA_4G12340?

The AFUA_4G12340 gene is located on chromosome 4 of the N. fumigata genome. Like other members of the SLC25 family, the encoded protein is predicted to contain six transmembrane domains with a tripartite structure typical of mitochondrial carrier proteins. The protein likely features the characteristic mitochondrial carrier protein signature motif P-X-[DE]-X-X-[RK]. Sequence analysis indicates conserved residues that form the substrate binding site, which determines the specificity for transported molecules. For thorough characterization, researchers should employ both computational prediction tools and experimental validation techniques including hydropathy analysis and topology mapping using reporter fusions.

How does AFUA_4G12340 compare to SLC25 proteins in other organisms?

AFUA_4G12340 shares significant sequence homology with SLC25A38 proteins in other organisms, suggesting evolutionary conservation of function. Comparative analysis with human SLC25 members reveals that SLC25A38 homologs typically function in heme biosynthesis pathways. While SLC25 members in humans have been extensively studied with 53 identified members and 37 differentially expressed members in contexts like colon cancer , fungal homologs require further characterization. Phylogenetic analysis indicates that fungal SLC25A38 homologs form a distinct clade within the SLC25 family tree. The protein likely maintains the core functional domains observed in other species while potentially exhibiting fungal-specific adaptations that could be exploited for targeted antifungal development.

What are the optimal methods for cloning and expressing recombinant AFUA_4G12340?

For optimal cloning and expression of recombinant AFUA_4G12340, researchers should follow these methodological steps:

  • Gene Amplification: Design primers to amplify the full coding sequence from N. fumigata genomic DNA or cDNA, adding appropriate restriction sites for subsequent cloning. Consider codon optimization if expressing in heterologous systems.

  • Vector Selection: For functional studies, choose expression vectors with affinity tags (His6, GST, or MBP) for purification. For localization studies, consider GFP fusion constructs.

  • Expression Systems:

    • Bacterial systems (E. coli): Use strains designed for membrane protein expression (C41/C43) with temperature reduction to 18-20°C after induction.

    • Yeast systems (S. cerevisiae, P. pastoris): Preferable for eukaryotic membrane proteins, especially when post-translational modifications are important.

    • Cell-free systems: Consider for difficult-to-express membrane proteins.

  • Induction and Expression Verification:

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Verify expression by Western blot using tag-specific or custom antibodies

    • Assess protein folding through functional assays

This approach draws on established techniques for membrane protein expression while addressing the specific challenges of fungal mitochondrial carriers .

How can AFUA_4G12340 gene knockout be achieved in N. fumigata?

For effective gene knockout of AFUA_4G12340 in N. fumigata, researchers should implement the following protocol based on established homologous recombination methods:

  • Construct Design: Create a knockout construct containing:

    • 5' and 3' flanking regions of AFUA_4G12340 (typically 1-2 kb each)

    • A selectable marker (e.g., hygromycin resistance gene hph1) to replace the target gene coding sequence

    • Optional: fluorescent markers for visual screening

  • Transformation Method:

    • Prepare protoplasts from germinating N. fumigata conidia

    • Transform protoplasts with the linearized knockout construct using PEG-mediated transformation

    • Plate on selective media containing hygromycin

  • Transformant Verification: Confirm knockout using multiple approaches:

    • PCR screening with primers spanning the integration site (similar to the approach used for easM knockout)

    • Southern blot analysis to confirm single integration

    • RT-PCR to verify absence of target gene transcript

    • Western blot to confirm absence of protein expression

  • Complementation: Generate complementation strains by reintroducing the wild-type gene to verify phenotypes are directly attributable to AFUA_4G12340 deletion.

This strategy follows proven methodology for gene disruption in filamentous fungi, ensuring rigorous validation of knockout strains through multiple confirmatory analyses .

What are the recommended procedures for functional characterization of AFUA_4G12340?

To comprehensively characterize AFUA_4G12340 function, researchers should implement a multi-faceted approach:

  • Transport Activity Assays:

    • Reconstitute purified protein in liposomes loaded with potential substrates

    • Measure substrate uptake over time using radiolabeled compounds or fluorescent probes

    • Determine kinetic parameters (Km, Vmax) for identified substrates

    • Assess inhibition profiles with known mitochondrial carrier inhibitors

  • Phenotypic Analysis of Knockout Strains:

    • Growth characteristics under various carbon sources and stress conditions

    • Mitochondrial function assessment (oxygen consumption, membrane potential)

    • Metabolomic profiling to identify accumulated or depleted metabolites

    • Transcriptomic analysis to identify compensatory pathways

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify interacting partners

    • Yeast two-hybrid or BioID proximity labeling to map the interaction network

    • Blue native PAGE to assess complex formation

  • In vivo Localization:

    • Fluorescent protein fusion imaging to confirm mitochondrial localization

    • Submitochondrial fractionation to verify inner membrane association

This comprehensive approach enables thorough functional characterization while accounting for potential compensatory mechanisms that may mask phenotypes in genetic knockout studies .

How does AFUA_4G12340 contribute to N. fumigata pathogenicity and virulence?

The contribution of AFUA_4G12340 to N. fumigata pathogenicity likely involves several mechanisms that can be investigated through these approaches:

  • Infection Models:

    • Compare virulence of wild-type and AFUA_4G12340 knockout strains in established murine models of invasive aspergillosis

    • Assess fungal burden, inflammatory responses, and survival rates

    • Examine tissue tropism and histopathological findings, similar to approaches used in studying other Neosartorya species

  • Host-Pathogen Interaction:

    • Evaluate growth in iron-limited conditions mimicking host environments

    • Assess resistance to host oxidative defense mechanisms

    • Measure interactions with macrophages and neutrophils (phagocytosis rates, survival)

  • Metabolic Adaptation:

    • Analyze metabolic flux under host-mimicking conditions

    • Investigate hypoxic adaptation capacity

    • Examine siderophore production and iron acquisition

  • Comparative Analysis:

    • Study expression patterns during infection using transcriptomic approaches

    • Compare with chronic granulomatous disease models, where Neosartorya infections show distinct chronicity (median duration of 35 weeks compared to 5.5 weeks for typical A. fumigatus infections)

Research should focus on whether AFUA_4G12340 supports metabolic adaptations necessary for survival in the host environment, potentially through maintaining mitochondrial function under stress or facilitating essential biosynthetic pathways during infection .

What computational approaches can predict substrate specificity of AFUA_4G12340?

Advanced computational methods can predict AFUA_4G12340 substrate specificity through:

  • Homology Modeling and Molecular Dynamics:

    • Generate protein structure models based on crystallized SLC25 family members

    • Perform molecular dynamics simulations to identify stable conformations

    • Analyze the substrate binding pocket characteristics (volume, electrostatic potential, hydrophobicity)

  • Docking Studies:

    • Virtual screening of potential substrates based on known mitochondrial metabolites

    • Calculate binding energies and identify key interacting residues

    • Rank potential substrates by binding affinity

  • Machine Learning Approaches:

    • Train models on known SLC25 family substrate specificities

    • Implement feature extraction from protein sequences and structures

    • Apply classification algorithms to predict substrate classes

  • Network-Based Predictions:

    • Integrate metabolic network data specific to N. fumigata

    • Identify metabolic gaps that AFUA_4G12340 might fill

    • Predict substrates based on network connectivity and metabolic module analysis

  • Evolutionary Analysis:

    • Perform sequence conservation analysis across species

    • Identify co-evolution patterns with metabolic enzymes

    • Trace evolutionary relationships with characterized transporters

These computational predictions should be validated experimentally through transport assays with predicted substrates using reconstituted systems or cellular uptake measurements in knockout/complementation strains .

How can proteomic approaches enhance understanding of AFUA_4G12340 function?

Proteomic approaches provide powerful tools for elucidating AFUA_4G12340 function through:

  • Differential Proteomics:

    • Compare proteome profiles between wild-type and AFUA_4G12340 knockout strains

    • Identify upregulated or downregulated proteins in response to gene deletion

    • Map affected pathways using enrichment analysis

  • Interactome Mapping:

    • Employ affinity purification coupled with mass spectrometry (AP-MS)

    • Implement proximity-dependent labeling methods (BioID, APEX)

    • Validate interactions using reciprocal co-immunoprecipitation or FRET analysis

  • Post-translational Modification Analysis:

    • Identify regulatory modifications (phosphorylation, acetylation, ubiquitination)

    • Map modification sites using LC-MS/MS

    • Correlate modifications with functional states

  • Structural Proteomics:

    • Apply cross-linking mass spectrometry to capture transient interactions

    • Implement hydrogen-deuterium exchange mass spectrometry to analyze conformational dynamics

    • Use limited proteolysis to identify flexible regions

  • Quantitative Transport Proteomics:

    • Measure substrate-induced conformational changes

    • Implement SILAC or TMT labeling for quantitative analysis

    • Correlate protein abundance with transport activity

These approaches should be integrated with functional data from knockout studies and transport assays to build a comprehensive model of AFUA_4G12340's role in fungal physiology and potential contributions to pathogenicity .

How can researchers address challenges in recombinant expression of AFUA_4G12340?

Researchers frequently encounter challenges when expressing recombinant mitochondrial carrier proteins like AFUA_4G12340. Here are methodological solutions:

  • Addressing Toxicity Issues:

    • Use tightly regulated inducible promoters (T7-lac, tet-regulated)

    • Employ low-copy number vectors to reduce basal expression

    • Select expression strains with reduced protease activity (BL21(DE3)pLysS, Rosetta)

    • Consider cell-free expression systems for highly toxic proteins

  • Resolving Inclusion Body Formation:

    • Optimize induction conditions (reduce temperature to 16-20°C, decrease inducer concentration)

    • Use solubility-enhancing fusion partners (SUMO, MBP, TrxA)

    • Co-express with molecular chaperones (GroEL/ES, DnaK/DnaJ)

    • Develop refolding protocols if inclusion bodies persist

  • Improving Membrane Integration:

    • Use expression hosts specialized for membrane proteins (C41/C43, LEMO21)

    • Co-express with membrane integrase YidC

    • Optimize membrane mimetics for extraction (detergent screening panel)

    • Consider nanodiscs or amphipols for stabilization

  • Addressing Poor Yield:

    • Scale up culture volume while maintaining optimal conditions

    • Implement fed-batch cultivation to achieve higher cell densities

    • Design codon-optimized synthetic genes for the expression host

    • Consider alternative expression systems (P. pastoris, insect cells)

  • Overcoming Purification Challenges:

    • Test multiple affinity tags (His6, Strep-tag II, FLAG)

    • Implement two-step purification strategies

    • Screen detergents for optimal extraction and stability

    • Use size exclusion chromatography as a final polishing step

These strategies should be systematically tested and optimized for AFUA_4G12340, as membrane protein expression requires empirical determination of optimal conditions .

What approaches can resolve contradictory functional data for AFUA_4G12340?

When facing contradictory functional data for AFUA_4G12340, researchers should implement the following systematic resolution approach:

  • Methodological Validation:

    • Reproduce experiments using standardized protocols across laboratories

    • Compare experimental conditions in detail (buffer composition, pH, temperature)

    • Cross-validate results using complementary techniques

    • Implement rigorous controls and blinding where appropriate

  • Strain Verification:

    • Confirm genetic background of all strains by whole-genome sequencing

    • Verify knockout constructs by multiple PCR assays targeting different regions

    • Check for compensatory mutations in knockout strains

    • Create new knockout strains using alternative strategies (CRISPR-Cas9)

  • Context-Dependent Analysis:

    • Investigate condition-specific effects (growth phase, media composition, stress)

    • Examine gene-environment interactions systematically

    • Test for substrate competition effects in transport assays

    • Consider post-translational regulation under different conditions

  • Structural Considerations:

    • Analyze protein conformational states under experimental conditions

    • Investigate oligomerization status and its impact on function

    • Consider allosteric regulation by cellular metabolites

    • Examine isoform-specific effects if alternative splicing occurs

  • Integrative Data Analysis:

    • Apply meta-analysis techniques to aggregate data across studies

    • Implement Bayesian approaches to weight evidence appropriately

    • Develop mathematical models to reconcile apparently contradictory results

    • Consider emergent properties that may explain contextual differences

This methodical approach enables researchers to identify the sources of discrepancy and develop a unified understanding of AFUA_4G12340 function .

What statistical methods are most appropriate for analyzing AFUA_4G12340 knockout phenotypes?

The analysis of AFUA_4G12340 knockout phenotypes requires rigorous statistical approaches:

  • For Growth and Morphological Analyses:

    • Two-way ANOVA to assess interactions between genotype and environmental conditions

    • Repeated measures designs for time-course experiments

    • Non-parametric alternatives (Kruskal-Wallis, Mann-Whitney U) for non-normally distributed data

    • Calculate effect sizes (Cohen's d or η²) to quantify biological significance

  • For Omics Data Analysis:

    • Implement appropriate normalization methods (quantile normalization for microarrays, TPM/RPKM for RNA-seq)

    • Apply multiple testing correction (Benjamini-Hochberg FDR) for high-dimensional data

    • Use limma or DESeq2 packages for differential expression analysis

    • Perform enrichment analysis (GSEA, GO term analysis) to identify affected pathways

  • For Transport Assays:

    • Fit kinetic data to appropriate models (Michaelis-Menten, Hill equation)

    • Use non-linear regression with weighting for heteroscedastic data

    • Apply Akaike Information Criterion (AIC) to select between competing models

    • Implement bootstrap resampling to generate robust confidence intervals

  • For Virulence Studies:

    • Use Kaplan-Meier survival analysis with log-rank tests

    • Apply Cox proportional hazards models for multivariate analysis

    • Consider mixed-effects models for repeated measures or clustered data

    • Calculate sample sizes a priori to ensure adequate statistical power

  • Experimental Design Considerations:

    • Implement randomization and blinding procedures

    • Include appropriate positive and negative controls

    • Conduct power analysis to determine sample size

    • Consider batch effects and technical variability

These statistical approaches enable robust interpretation of knockout phenotypes while accounting for experimental variability and multiple comparisons .

What are the emerging approaches for studying AFUA_4G12340 in pathogenicity models?

The investigation of AFUA_4G12340's role in pathogenicity can be advanced through several innovative approaches:

  • Advanced Infection Models:

    • Develop 3D organoid models of human lung tissue for more physiologically relevant infection studies

    • Implement humanized mouse models that better recapitulate human immune responses

    • Utilize zebrafish larvae for high-throughput in vivo screening with real-time imaging capabilities

    • Create chronic granulomatous disease models, where Neosartorya species show distinct infection patterns

  • Systems Biology Integration:

    • Implement multi-omics approaches (transcriptomics, proteomics, metabolomics) during infection

    • Develop computational models of host-pathogen interactions incorporating AFUA_4G12340 function

    • Apply network analysis to identify key nodes in pathogenicity networks

    • Develop predictive models for virulence based on mitochondrial transporter activity

  • Single-Cell Technologies:

    • Apply single-cell RNA-seq to heterogeneous fungal populations during infection

    • Implement spatial transcriptomics to map gene expression in infected tissues

    • Utilize CyTOF or spectral flow cytometry to characterize host immune responses

    • Develop fungal-specific CRISPR screens for virulence factor identification

  • Advanced Microscopy:

    • Apply super-resolution microscopy to visualize AFUA_4G12340 localization during infection

    • Implement intravital microscopy to track fungal-host interactions in real-time

    • Utilize correlative light and electron microscopy to connect function with ultrastructure

    • Develop biosensors to monitor metabolite transport in living cells

These emerging approaches will provide deeper insights into the specific contributions of AFUA_4G12340 to fungal pathogenicity and potentially identify novel therapeutic targets for invasive aspergillosis .

How might AFUA_4G12340 be exploited for antifungal drug development?

The mitochondrial solute carrier AFUA_4G12340 presents several promising avenues for antifungal drug development:

  • Structure-Based Drug Design:

    • Generate high-resolution structures of AFUA_4G12340 through crystallography or cryo-EM

    • Identify binding pockets unique to fungal transporters compared to human homologs

    • Implement virtual screening campaigns targeting identified pockets

    • Design small molecule inhibitors through fragment-based approaches

  • Functional Inhibition Strategies:

    • Develop transport assays amenable to high-throughput screening

    • Screen for compounds that selectively inhibit fungal but not human SLC25 transporters

    • Target substrate binding or conformational changes essential for transport

    • Design peptidomimetics that disrupt protein-protein interactions essential for function

  • Exploiting Metabolic Vulnerabilities:

    • Identify metabolic pathways dependent on AFUA_4G12340 function

    • Develop combination therapies targeting the transporter and dependent pathways

    • Create "metabolic synthetic lethality" approaches by simultaneously inhibiting redundant pathways

    • Design prodrugs activated by fungal-specific metabolic processes

  • Translation to Clinical Applications:

    • Assess selectivity indexes against human cell lines

    • Evaluate pharmacokinetic and pharmacodynamic properties

    • Test efficacy in animal models of invasive aspergillosis

    • Develop biomarkers to monitor treatment response

This multi-faceted approach leverages the understanding of AFUA_4G12340 function to develop targeted antifungal therapies with potentially improved specificity and reduced toxicity compared to current antifungal agents .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.