Recombinant Neosartorya fumigata Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
vma21; AFUA_3G08410; Vacuolar ATPase assembly integral membrane protein vma21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Target Names
vma21
Target Protein Sequence
MTSRRSQEKSYAEAAAAPPPKESASSDVTPAVPADVIYKLLGFTAAMVVGPIGMYFVTVN SGGMSFFHQTSNFSLFETLTRIASPTVAGITAAITANLVLFGYIYVAWLDDREEREAASK RNEKKAQ
Uniprot No.

Target Background

Function
Essential for the assembly of the vacuolar ATPase (V-ATPase) V0 complex within the endoplasmic reticulum.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is Neosartorya fumigata and how does it relate to Aspergillus fumigatus?

Neosartorya fumigata is taxonomically related to Aspergillus fumigatus, one of the most common fungal pathogens affecting immunocompromised individuals. Genetic-based methods have revealed that organisms phenotypically identified as A. fumigatus actually constitute a mold complex, designated Aspergillus section fumigati subgenus fumigati . Neosartorya fumigata is part of this complex. While these fungi share morphological similarities, molecular sequencing shows distinct genetic differences that affect pathogenicity and drug response profiles. Clinical cases of Neosartorya infections differ from typical A. fumigatus infections in their chronicity, tissue invasion patterns, and response to antifungal therapies .

What is the Vacuolar ATPase assembly integral membrane protein VMA21 and its function?

VMA21 is an integral membrane protein that plays a critical role in the assembly of Vacuolar ATPase (V-ATPase) complexes. Based on its amino acid sequence and structural analysis, VMA21 in Neosartorya fumigata contains transmembrane domains that integrate into intracellular membranes, particularly the endoplasmic reticulum . Its primary function is to serve as an assembly factor that ensures proper folding and integration of the V0 domain subunits of the V-ATPase complex. Without functional VMA21, V-ATPase complexes fail to assemble correctly, compromising vacuolar acidification and consequently affecting multiple cellular processes including protein sorting, vesicular trafficking, and ion homeostasis.

Why does recombinant VMA21 protein production present unique challenges?

Recombinant production of VMA21 presents multiple challenges due to its integral membrane nature. As observed in product specifications, VMA21 contains hydrophobic transmembrane regions that can cause protein aggregation when expressed in heterologous systems . Additionally, proper folding of fungal membrane proteins often requires specific lipid environments and chaperone assistance. During recombinant expression, maintaining the native conformation is particularly challenging, as improper folding can expose hydrophobic regions that normally would be membrane-embedded. This often necessitates optimization of expression conditions, including temperature reduction, specialized host strains, and the use of solubility-enhancing fusion tags to obtain functional protein for research applications.

What expression systems are most effective for producing recombinant Neosartorya fumigata VMA21?

When expressing recombinant Neosartorya fumigata VMA21, researchers should consider the following systems based on experimental objectives:

Expression SystemAdvantagesDisadvantagesOptimal Conditions
E. coli (BL21-CodonPlus)High yield, rapid growth, cost-effectiveMay form inclusion bodies, lacks eukaryotic PTMs16-18°C induction, 0.1-0.5mM IPTG, specialized membrane protein vectors
Pichia pastorisProper protein folding, glycosylation capability, high-density cultureLonger expression time, more complex protocolsMethanol induction at 0.5%, 48-72h expression, buffered media pH 6.0
Insect cells (Sf9)Advanced eukaryotic PTMs, better membrane protein foldingHigher cost, technical complexity27°C, low MOI infection, 72-96h expression period
Mammalian cells (HEK293)Most sophisticated folding machineryHighest cost, lowest yieldTransient transfection, 30-48h expression, serum-free media

For VMA21, which contains multiple transmembrane domains, expression in Pichia pastoris often provides the best balance between proper folding and reasonable yield . Yeast systems are particularly appropriate as they are phylogenetically closer to the native fungal environment.

What purification strategies maximize yield and stability of recombinant VMA21?

Purification of recombinant VMA21 requires specialized approaches to maintain protein stability and functionality:

  • Membrane extraction and solubilization:

    • Gentle cell disruption using glass bead homogenization or pressure-based lysis

    • Membrane fraction isolation via differential ultracentrifugation (100,000×g)

    • Solubilization using mild detergents (0.5-1% DDM or 1-2% LDAO) supplemented with 10-20% glycerol as a stabilizer

  • Chromatographic purification sequence:

    • Initial capture via immobilized metal affinity chromatography (IMAC) using His-tagged constructs

    • Intermediate purification through ion exchange chromatography at pH values away from VMA21's theoretical pI

    • Polishing via size exclusion chromatography to remove aggregates and ensure homogeneity

  • Critical stability considerations:

    • Maintenance of detergent concentration above critical micelle concentration throughout purification

    • Addition of specific lipids (0.1-0.2 mg/mL phospholipids) to stabilize native conformation

    • Inclusion of reducing agents (1-5mM DTT or TCEP) to prevent oxidation of cysteine residues

    • Storage in 50% glycerol at -20°C for extended stability

Researchers should validate purification success through both SDS-PAGE and functional assays to ensure the protein maintains its native conformation.

How can researchers verify proper folding and functionality of purified VMA21?

Verification of proper folding and functionality requires multiple complementary approaches:

  • Structural assessment techniques:

    • Circular dichroism spectroscopy to confirm alpha-helical content expected from transmembrane domains

    • Thermal shift assays to determine protein stability under various buffer conditions

    • Limited proteolysis to identify properly folded domains resistant to digestion

    • Native PAGE to assess oligomeric state in detergent micelles

  • Functional verification methods:

    • Reconstitution into liposomes to confirm membrane integration capability

    • Co-immunoprecipitation with known interaction partners from V-ATPase complex

    • Complementation assays in VMA21-deficient yeast strains

    • Monitoring pH-dependent fluorescence changes in reconstituted systems

  • Biophysical interaction studies:

    • Surface plasmon resonance (SPR) to measure binding kinetics with V-ATPase components

    • Microscale thermophoresis to quantify protein-protein interactions in detergent solutions

    • Hydrogen-deuterium exchange mass spectrometry to map structural dynamics and binding interfaces

Successful verification requires positive results from multiple techniques, as no single assay conclusively confirms proper folding of membrane proteins like VMA21.

How does VMA21 contribute to fungal virulence and pathogenesis?

VMA21's role in fungal virulence stems from its essential function in V-ATPase assembly, which affects multiple pathogenesis pathways:

  • Vacuolar acidification and enzyme activation:

    • Proper VMA21 function ensures V-ATPase-mediated acidification of fungal vacuoles

    • Acidic environments activate degradative enzymes required for nutrient acquisition in host tissues

    • Vacuolar function supports adaptation to nutrient-limited host environments

  • Stress response and adaptation:

    • V-ATPase activity regulated by VMA21 contributes to metal ion detoxification

    • Vacuolar function supports osmoregulation during infection process

    • Stress adaptation mechanisms facilitated by vacuolar function enhance survival in phagocytes

  • Secretion of virulence factors:

    • VMA21-dependent vesicular trafficking affects secretion of hydrolytic enzymes

    • Proper protein sorting ensures cell wall components essential for host interaction reach their destinations

    • Defects in VMA21 function may alter the composition of secreted molecules that modulate host immunity

  • Drug resistance mechanisms:

    • V-ATPase function impacts the activity of efflux pumps involved in antifungal resistance

    • Vacuolar sequestration of antifungal compounds reduces their effective concentration

    • pH homeostasis affects susceptibility to pH-dependent antifungals

Clinical evidence supports these connections, as infections with Neosartorya species demonstrate distinctive chronicity and resistance to standard therapies compared to typical Aspergillus infections .

What advantages do structure-based approaches offer for studying VMA21 function?

Structure-based approaches provide unique insights into VMA21 function that complement genetic and biochemical studies:

  • Membrane topology and functional domains:

    • Cryo-electron microscopy of VMA21 complexes reveals precise membrane integration orientation

    • Computational modeling based on the amino acid sequence (127 residues) identifies key functional domains

    • Structure prediction algorithms applied to the VMA21 sequence suggest multiple transmembrane helices with specific interaction surfaces

  • Interaction interface mapping:

    • Structural studies reveal binding sites for V-ATPase V0 domain components

    • Molecular dynamics simulations identify conformational changes during protein-protein interactions

    • Mutational analysis guided by structural insights validates key interaction residues

  • Comparative structural biology:

    • Structural comparison between VMA21 from Neosartorya fumigata and human homologs highlights fungal-specific features

    • Identification of structural differences that could be exploited for selective targeting

    • Evolutionary conservation analysis mapped onto structural models reveals functionally critical regions

  • Drug discovery applications:

    • Structure-guided virtual screening identifies potential binding pockets unique to fungal VMA21

    • Fragment-based drug design approaches utilize structural data to develop selective inhibitors

    • Structure-activity relationship studies optimize compound interactions with fungal-specific features

These approaches are particularly valuable for membrane proteins like VMA21, where traditional biochemical techniques face limitations due to the hydrophobic nature of the protein.

What is the relationship between VMA21 function and antifungal resistance mechanisms?

The relationship between VMA21 function and antifungal resistance involves several interconnected mechanisms:

  • pH-dependent drug efficacy:

    • VMA21-mediated V-ATPase assembly affects intracellular and vacuolar pH

    • Many antifungals, particularly azoles, have pH-dependent activity profiles

    • Alterations in vacuolar acidification can reduce drug efficacy in fungal compartments

  • Vacuolar drug sequestration:

    • Proper vacuolar function allows compartmentalization of antifungal compounds

    • Sequestration reduces effective drug concentration at target sites

    • This mechanism is particularly relevant for amphotericin B and azole antifungals

  • Efflux pump regulation:

    • V-ATPase activity provides proton gradients that drive secondary active transport

    • ATP-binding cassette (ABC) transporters involved in drug efflux depend on these gradients

    • VMA21 dysfunction can impair efflux pump efficiency

  • Stress response integration:

    • VMA21-dependent vacuolar function affects cellular stress responses

    • Antifungal drugs induce stress that requires vacuolar processing

    • Upregulation of VMA21 may occur as part of the cellular response to antifungal exposure

The clinical significance of these connections is evident in infections with Neosartorya species, which demonstrated higher minimum inhibitory concentrations to various antifungal agents compared with contemporary A. fumigatus sensu stricto isolates , potentially reflecting differences in vacuolar function and associated resistance mechanisms.

How can VMA21-based assays improve diagnosis of Neosartorya infections?

VMA21-based diagnostic approaches offer several advantages for identifying Neosartorya infections:

  • Species-specific molecular detection:

    • PCR primers targeting unique regions of the VMA21 gene can differentiate Neosartorya from Aspergillus fumigatus

    • Quantitative PCR assays using VMA21 sequences provide rapid identification with high sensitivity

    • Next-generation sequencing targeting the VMA21 locus and surrounding regions enables strain typing

  • Immunological detection methods:

    • Recombinant VMA21 protein can generate specific antibodies for immunohistochemistry of tissue samples

    • Enzyme-linked immunosorbent assays using VMA21 epitopes detect fungal antigens in patient specimens

    • Lateral flow assays incorporating anti-VMA21 antibodies offer point-of-care testing options

  • Proteomic identification markers:

    • Mass spectrometry detection of VMA21-derived peptides in clinical samples provides species identification

    • VMA21 peptide fingerprints differentiate between closely related fungal species

    • Integration of VMA21 markers into broader proteomic panels enhances diagnostic accuracy

  • Clinical relevance for challenging cases:

    • VMA21-based diagnostics are particularly valuable for chronic, refractory infections

    • Identification of Neosartorya species can explain unusual clinical presentations or treatment failures

    • Early species differentiation guides appropriate therapeutic decisions

These approaches address the clinical need for better differentiation between Aspergillus and Neosartorya infections, as invasive aspergillosis due to Neosartorya presents with distinctive chronicity and resistance patterns that require modified treatment strategies .

What are the potential challenges in targeting VMA21 for antifungal drug development?

Developing antifungals targeting VMA21 presents several challenges that researchers must address:

  • Selectivity constraints:

    • Human cells possess homologous V-ATPase assembly proteins

    • Achieving fungal selectivity requires exploiting subtle structural differences

    • Potential for off-target effects on host V-ATPase assembly

  • Membrane protein accessibility:

    • VMA21's intracellular membrane localization limits drug accessibility

    • Compounds must cross both fungal cell wall and plasma membrane

    • Hydrophilic compounds may struggle to reach the intracellular target

  • Functional redundancy considerations:

    • Fungi may possess compensatory mechanisms for V-ATPase assembly

    • Partial inhibition might be insufficient for antifungal activity

    • Resistance could develop through alternative assembly pathways

  • Development and validation hurdles:

    • Limited established assays for high-throughput screening of VMA21 inhibitors

    • Challenges in expressing sufficient quantities of protein for structural studies

    • Need for specialized models to evaluate efficacy against chronic Neosartorya infections

Despite these challenges, the unique aspects of fungal V-ATPase assembly and the critical role of VMA21 make it a promising target, particularly for addressing difficult-to-treat infections like those caused by Neosartorya species that demonstrate resistance to conventional therapies .

What protein engineering approaches optimize recombinant VMA21 for research applications?

Strategic protein engineering can significantly enhance the utility of recombinant VMA21:

  • Solubility enhancement strategies:

    • Fusion with solubility-enhancing tags (MBP, SUMO, or Trx) at the N-terminus

    • Introduction of surface-exposed charged residues to reduce aggregation

    • Selective mutation of exposed hydrophobic residues without compromising function

    • Creation of truncated constructs focusing on specific domains

  • Purification and detection optimization:

    • Strategic placement of affinity tags to minimize interference with function

    • Introduction of site-specific protease cleavage sites for tag removal

    • Addition of fluorescent protein fusions for localization and interaction studies

    • Engineering of biotinylation sites for proximity labeling applications

  • Stability enhancement modifications:

    • Introduction of disulfide bridges to stabilize tertiary structure

    • Mutation of oxidation-prone methionine residues

    • Removal of proteolytically sensitive regions

    • Incorporation of thermostabilizing mutations identified through directed evolution

  • Functional optimization:

    • Creation of constitutively active variants through regulatory domain modifications

    • Development of inducible systems for temporal control of activity

    • Engineering of interaction-deficient mutants as negative controls

    • Design of substrate-trapped versions for interaction partner identification

These engineering approaches should be guided by the 127-amino acid sequence of the VMA21 protein , with careful consideration of transmembrane domains and functional regions essential for V-ATPase assembly.

What experimental systems best model VMA21 function in host-pathogen interactions?

Several experimental systems offer complementary insights into VMA21 function during host-pathogen interactions:

  • Cell-based infection models:

    • Human bronchial epithelial cell lines infected with wildtype vs. VMA21-modified fungi

    • Macrophage challenge assays to assess phagocytosis and intracellular survival

    • 3D organoid cultures of lung tissue for more physiologically relevant interactions

    • Co-culture systems incorporating multiple cell types to model tissue interfaces

  • Genetic manipulation approaches:

    • CRISPR-Cas9 modification of VMA21 in Neosartorya fumigata

    • Conditional expression systems to study temporal aspects of VMA21 function

    • Fluorescent tagging for real-time visualization during infection

    • Complementation experiments with VMA21 variants to assess structure-function relationships

  • Animal models for in vivo assessment:

    • Neutropenic mouse models of invasive aspergillosis

    • Chronic granulomatous disease mouse models to recapitulate the clinical scenario observed in patients

    • Zebrafish transparent embryo models for real-time visualization of fungal-host interactions

    • Galleria mellonella larvae as a rapid, cost-effective preliminary screening system

  • Comparative systems biology:

    • Transcriptomic profiling of VMA21 wildtype vs. mutant fungi during infection

    • Proteomics to identify VMA21-dependent secreted factors

    • Metabolomic analysis to characterize changes in fungal metabolism during host adaptation

    • Network analysis integrating multiple -omics datasets to identify VMA21-dependent pathways

These systems are particularly relevant for understanding how VMA21 contributes to the distinctive pathogenesis of Neosartorya infections, which show unusual chronicity and tissue invasion patterns compared to typical Aspergillus infections .

What emerging technologies will advance our understanding of VMA21 biology?

Several cutting-edge technologies promise to deepen our understanding of VMA21 biology:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for high-resolution structures of VMA21 in membrane environments

    • Integrative structural biology combining X-ray crystallography, NMR, and computational modeling

    • Single-particle analysis of VMA21 complexes with V-ATPase components

    • Time-resolved structural techniques to capture assembly intermediates

  • Spatiotemporal dynamics visualization:

    • Super-resolution microscopy to track VMA21 localization during infection

    • Lattice light-sheet microscopy for long-term imaging with minimal phototoxicity

    • Split fluorescent protein systems to visualize protein-protein interactions in live cells

    • Correlative light and electron microscopy to combine functional and ultrastructural data

  • Systems-level analysis techniques:

    • Single-cell RNA sequencing to capture heterogeneity in fungal responses

    • Spatial transcriptomics to map gene expression across infection sites

    • Multi-omics integration to develop comprehensive models of VMA21 function

    • Machine learning approaches to identify patterns in complex datasets

  • Precision genome editing:

    • Base editing for introducing specific mutations without double-strand breaks

    • Prime editing for precise genomic modifications in difficult-to-transform fungi

    • CRISPR interference for temporal and reversible regulation of VMA21 expression

    • Synthetic genomics approaches to redesign VMA21 pathways

These technologies will help address the complex relationship between VMA21 function and the distinctive clinical presentations of Neosartorya infections, which demonstrate unusual chronicity and resistance to standard therapies .

How might comparative genomic approaches inform VMA21 research across fungal pathogens?

Comparative genomic approaches offer powerful insights into VMA21 biology across fungal pathogens:

  • Evolutionary analysis and selection pressure:

    • Phylogenetic analysis of VMA21 sequences reveals evolutionary relationships between fungal species

    • Detection of positive selection signatures identifies adaptation during host specialization

    • Identification of conserved regions crucial for function across diverse fungi

    • Mapping of species-specific variations that may correlate with pathogenicity differences

  • Genomic context and regulation:

    • Examination of VMA21 locus organization across fungal genomes

    • Identification of conserved vs. species-specific regulatory elements

    • Analysis of synteny patterns to understand genomic rearrangements

    • Detection of potential horizontal gene transfer events affecting V-ATPase assembly

  • Functional genomic comparisons:

    • Transcriptomic profiling across species in response to similar stressors

    • Comparative genetic interaction mapping to identify species-specific pathways

    • Cross-species complementation experiments to test functional conservation

    • Multi-species phenotypic screening to identify shared vulnerabilities

  • Clinical isolate diversity analysis:

    • Sequencing of VMA21 from clinical isolates with varying virulence or drug resistance

    • Genome-wide association studies linking VMA21 variants to clinical outcomes

    • Population genomics to understand selective pressures in clinical environments

    • Integration of genomic data with patient outcomes to identify virulence determinants

This comparative approach is particularly valuable given the demonstrated clinical differences between Neosartorya and Aspergillus fumigatus infections, with the former showing distinctive chronicity, tissue invasion patterns, and drug response profiles that may reflect underlying genetic differences .

What are the most critical unanswered questions regarding VMA21 in fungal pathogenesis?

Despite progress in understanding VMA21, several critical questions remain unanswered:

  • Structural determinants of species-specific function:

    • How do subtle differences in VMA21 sequence between Neosartorya and Aspergillus affect V-ATPase assembly?

    • Which structural features account for potential differences in drug susceptibility?

    • How does the protein's membrane topology influence its interaction with other components?

  • Regulatory mechanisms during infection:

    • How is VMA21 expression and function regulated during different stages of infection?

    • What environmental signals in the host modulate VMA21 activity?

    • How does VMA21 function change in response to antifungal exposure?

  • Contribution to chronic infection phenotypes:

    • How does VMA21-mediated vacuolar function contribute to the persistence of Neosartorya infections?

    • What role does it play in the distinctive tissue invasion patterns observed clinically?

    • How does it interact with host defense mechanisms during long-term infections?

  • Therapeutic targeting potential:

    • Can VMA21 be selectively targeted without affecting host V-ATPase assembly?

    • Would VMA21 inhibition increase susceptibility to existing antifungals?

    • Could combinatorial approaches targeting VMA21 and other pathways overcome resistance?

Addressing these questions could significantly advance our understanding of the molecular basis for the distinctive clinical presentations observed in Neosartorya infections, which demonstrate unusual chronicity and resistance to standard therapies compared to typical Aspergillus infections .

How might VMA21 research impact broader understanding of fungal membrane protein biology?

VMA21 research has implications that extend beyond this specific protein:

  • Methodology advancement:

    • Techniques optimized for VMA21 expression and purification can benefit studies of other fungal membrane proteins

    • Structural approaches successful with VMA21 may provide templates for related proteins

    • Functional assays developed for VMA21 could be adapted for other assembly factors

  • Evolutionary insights:

    • Understanding VMA21 conservation and divergence informs broader fungal phylogeny

    • Patterns of selection observed in VMA21 may reflect general principles of membrane protein evolution

    • Comparative studies can reveal how membrane proteins adapt to different ecological niches

  • Therapeutic approach development:

    • Strategies developed for targeting VMA21 could inform approaches to other membrane protein targets

    • Lessons about selectivity between fungal and human homologs have broad applicability

    • Understanding resistance mechanisms related to VMA21 may reveal patterns relevant to other targets

  • Fundamental biology contributions:

    • Insights into how membrane proteins coordinate organelle assembly

    • Understanding of protein quality control mechanisms in the secretory pathway

    • Elucidation of how membrane protein function adapts during pathogenesis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.