Recombinant Neotoma floridana NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Neotoma floridana MT-ND3 is a full-length mitochondrial protein expressed in Escherichia coli and purified for biochemical studies . It belongs to the NADH dehydrogenase family and is integral to the function of Complex I, facilitating electron transfer from NADH to ubiquinone during oxidative phosphorylation .

Key Features:

PropertyDetails
Source OrganismNeotoma floridana (Eastern woodrat)
Expression SystemE. coli
TagHis tag (N-terminal)
Protein Length115 amino acids
Molecular Weight~13 kDa
Purity>90% (verified by SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Functional Role:

  • Catalyzes electron transfer from NADH to ubiquinone, contributing to proton gradient generation .

  • Forms part of the transmembrane core of Complex I, critical for structural integrity .

Production and Quality Control

The recombinant protein is produced via bacterial expression and purified using affinity chromatography. Key quality metrics include:

Production Workflow:

  1. Gene Cloning: Full-length MT-ND3 gene (1–115 aa) inserted into an E. coli vector.

  2. Expression: Induced under optimized conditions for soluble protein yield.

  3. Purification: Immobilized metal-affinity chromatography (IMAC) for His-tag isolation .

  4. Formulation: Lyophilized in a stabilizing buffer to enhance shelf life .

Research Applications

Recombinant MT-ND3 is primarily used in:

  • Enzyme Activity Assays: Studying Complex I function and inhibition .

  • Structural Biology: Investigating mitochondrial membrane protein interactions .

  • Disease Modeling: Exploring mutations linked to mitochondrial disorders (e.g., Leigh syndrome) .

Example Study Design:

ApplicationExperimental UseCitation
ELISAQuantifying MT-ND3 levels in mitochondrial extracts
SDS-PAGEPurity verification and molecular weight analysis
Oxidative Stress AssaysAssessing ROS production in cancer models

Clinical and Evolutionary Insights

While Neotoma floridana MT-ND3 itself has not been directly linked to human diseases, polymorphisms in human MT-ND3 (e.g., rs28358278, rs2853826) are associated with:

  • Gastric Cancer Risk: Increased susceptibility linked to specific SNPs .

  • Neurodegenerative Disorders: Pathogenic variants implicated in Leigh syndrome and mitochondrial encephalopathies .

Comparative Analysis with Other Species

The MT-ND3 gene in Neotoma floridana shares functional homology with human MT-ND3 but exhibits species-specific sequence variations. For example:

FeatureNeotoma floridanaHuman (Homo sapiens)
UniProt IDO21578P03897
Amino Acid Length115115
Key Structural MotifsTransmembrane helicesConserved iron-sulfur binding regions

Future Research Directions

  • Functional Studies: Characterizing enzymatic kinetics in Neotoma floridana mitochondrial extracts.

  • Therapeutic Screening: Using recombinant MT-ND3 to identify Complex I inhibitors/activators.

  • Evolutionary Studies: Exploring the role of untranslated nucleotides in avian and reptilian homologs .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please include this information in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery information.
Note: Our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Neotoma floridana (Eastern woodrat) (Mus floridanus)
Target Names
Target Protein Sequence
MNMLLAMLINITLSLLLISIAFWLPQLNIYTEKANPYDWGFDPMSSARLPFSMKFFLVAI TFLLFDLEIALLLPIPWAIQIHSINTMMLTAFILVTILALGLAYEWIQKGLEWTE
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This protein catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. It is essential for the catalytic activity of complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How is recombinant MT-ND3 protein typically produced for research purposes?

Recombinant MT-ND3 protein is typically produced using prokaryotic expression systems, predominantly in E. coli. The production process involves cloning the full-length MT-ND3 gene (positions 1-115) into appropriate expression vectors, often incorporating affinity tags to facilitate purification .

The expression protocol generally includes:

  • Transformation of the expression construct into competent E. coli cells

  • Culture growth under optimized conditions for protein induction

  • Cell harvesting and lysis

  • Protein purification via affinity chromatography (commonly using His-tag affinity)

  • Quality control assessment by SDS-PAGE to ensure purity (typically >90%)

  • Lyophilization or buffer exchange for final formulation

Commercially available recombinant MT-ND3 proteins are commonly tagged with N-terminal affinity tags such as 10xHis, which facilitates downstream purification and applications. The expression region typically covers the full protein sequence (amino acids 1-115) .

What storage conditions are optimal for maintaining recombinant MT-ND3 protein stability?

For optimal stability of recombinant MT-ND3 protein, the following storage conditions are recommended:

  • Long-term storage: Store at -20°C or preferably -80°C for extended stability

  • Working aliquots: Store at 4°C for up to one week to minimize freeze-thaw cycles

  • Storage buffer: Typically formulated in Tris-based buffers with 50% glycerol for enhanced stability

  • Reconstitution protocol for lyophilized protein:

    • Briefly centrifuge the vial prior to opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is commonly recommended)

    • Aliquot to minimize freeze-thaw cycles

Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein stability and activity. The shelf life of liquid formulations is approximately 6 months at -20°C/-80°C, while lyophilized preparations can maintain stability for up to 12 months when properly stored .

What are the primary applications of recombinant MT-ND3 in basic research?

Recombinant MT-ND3 protein serves multiple research applications in the field of mitochondrial biology and disease research:

  • Structural and functional studies: Investigation of the protein's role in respiratory chain complex I assembly and function

  • Antibody production and validation: Generation of specific antibodies for detection of native MT-ND3 in tissue samples or cellular fractions

  • Protein-protein interaction studies: Examination of binding partners and complex formation within the mitochondrial respiratory chain

  • Disease mechanism investigations: Study of MT-ND3 mutations associated with mitochondrial disorders, particularly Leigh syndrome and other neurodegenerative conditions

  • Development of diagnostic tools: Creation of ELISA-based or other immunological detection methods for MT-ND3 variants in clinical samples

  • Reference standard: Use as a positive control in analytical techniques such as SDS-PAGE, Western blotting, and mass spectrometry

The application of recombinant MT-ND3 in these contexts has significantly advanced our understanding of mitochondrial function and the pathophysiology of related disorders.

How can recombinant MT-ND3 be utilized in therapeutic strategies for mitochondrial diseases?

Recombinant MT-ND3 represents a promising tool in developing therapeutic strategies for mitochondrial diseases, particularly those involving MT-ND3 mutations. Key methodological approaches include:

  • mRNA-based therapeutics: Delivery of wild-type MT-ND3 mRNA to mitochondria in diseased cells can potentially reduce the mutation rate and restore function. This approach has been investigated using specialized delivery systems such as MITO-Porter .

The process involves:

  • Design of therapeutic wild-type mRNA (ND3) with appropriate modifications (e.g., ATG start codon instead of ATA)

  • Packaging into mitochondria-targeted delivery systems

  • Transfection into diseased cells

  • Evaluation of heteroplasmy levels using amplification refractory mutation system (ARMS)-quantitative PCR

  • Assessment of functional outcomes through measurements of mitochondrial respiration

  • Gene therapy approaches: Development of vectors capable of delivering functional MT-ND3 genes to affected tissues

  • Protein replacement strategies: Direct supplementation of functional recombinant MT-ND3 protein using specialized delivery systems that can penetrate mitochondrial membranes

These therapeutic approaches have shown promise in experimental models, with evidence that delivery of wild-type MT-ND3 mRNA can reduce mutation load and potentially restore mitochondrial function in cells affected by Leigh syndrome and other mitochondrial disorders .

What are the known MT-ND3 mutations associated with human diseases, and how can recombinant proteins help study them?

Several MT-ND3 mutations have been identified and associated with various human diseases:

MutationAssociated DiseaseFunctional ImpactResearch Application
m.10191T>CLeigh syndromeImpaired complex I assembly/functionDisease mechanism studies, therapeutic testing
m.10158T>CLeigh syndromeMitochondrial respiratory chain dysfunctionGenotype-phenotype correlation studies
rs28358278Gastric cancer (in females)Potentially increased ROS productionCancer risk assessment
rs2853826Type 2 diabetes, gastric cancerIncreased ROS productionMetabolic disease mechanisms
rs41467651Gastric cancerUndeterminedCancer susceptibility markers
rs201397417Under investigationUnder investigationPolymorphism studies
rs28358275Under investigationUnder investigationPolymorphism studies

Recombinant MT-ND3 proteins can facilitate research on these mutations through:

  • Structure-function studies: Site-directed mutagenesis to introduce disease-associated mutations into recombinant proteins allows for functional characterization and structural analysis

  • Biochemical assays: Comparison of wild-type and mutant protein activities in reconstituted systems to assess electron transport efficiency and ROS production

  • Protein-protein interaction analysis: Investigation of how mutations affect assembly into complex I and interactions with other respiratory chain components

  • Development of diagnostic tools: Creation of mutation-specific antibodies or assays to detect and quantify mutant proteins in patient samples

The mutational analysis of Leigh syndrome patients has revealed that the m.10191T>C mutation is more common than m.10158T>C, with heteroplasmy (mutant load) typically ranging from 57.9% to 93.6% .

What experimental challenges exist in studying MT-ND3 function, and how can they be addressed?

Studying MT-ND3 function presents several significant experimental challenges:

  • Protein hydrophobicity and stability issues:

    • MT-ND3 is a highly hydrophobic transmembrane protein, making it difficult to maintain in soluble form

    • Solution: Use of specialized detergents, amphipols, or nanodiscs during purification and functional studies

    • Incorporation of stabilizing tags and optimization of buffer composition (e.g., inclusion of glycerol)

  • Mitochondrial targeting and import:

    • Delivering exogenous MT-ND3 or its mRNA to mitochondria is challenging due to the double membrane barrier

    • Solution: Development of specialized delivery systems such as MITO-Porter that can facilitate mitochondrial entry

    • Rigorous purification steps to ensure mitochondrial localization (e.g., RNase treatment of isolated mitochondria to remove surface-bound RNA)

  • Heteroplasmy quantification:

    • Accurate measurement of wild-type to mutant ratios requires sensitive methods

    • Solution: Implementation of ARMS-quantitative PCR with carefully designed primers for specific detection of wild-type and mutant sequences

    • Development of standard curves using known mixtures of wild-type and mutant templates

  • Functional assessment:

    • Isolating the specific contribution of MT-ND3 within the larger complex I is technically challenging

    • Solution: Complementation studies in cells harboring MT-ND3 mutations

    • Measurement of respiratory chain activity using oxygen consumption assays and complex I-specific activity measurements

  • Translation optimization:

    • MT-ND3 may use non-standard translation initiation (ATA instead of ATG)

    • Solution: Modification of start codon to ATG in recombinant constructs

    • Optimization of codon usage for the expression system being employed

Addressing these challenges requires a multidisciplinary approach combining techniques from molecular biology, biochemistry, and cell biology to obtain meaningful results.

How can researchers design experiments to investigate the role of MT-ND3 polymorphisms in disease susceptibility?

Designing robust experiments to investigate MT-ND3 polymorphisms in disease susceptibility requires a systematic approach:

  • Study design and cohort selection:

    • Case-control studies with carefully matched populations

    • Stratification by relevant factors (e.g., sex, age, environmental exposures)

    • Adequate sample size calculation based on expected effect sizes (e.g., the study by Jung et al. included 377 gastric cancer patients and 363 controls)

  • Genotyping methodology:

    • Direct sequencing of the MT-ND3 gene region for comprehensive polymorphism detection

    • Development of specific primers for SNPs of interest (e.g., rs28358278, rs2853826, rs201397417, rs41467651, and rs28358275)

    • Validation of genotyping accuracy with replicate samples and alternative methods

  • Functional validation approaches:

    • Creation of cellular models expressing different MT-ND3 variants

    • Measurement of:

      • Complex I activity

      • ROS production

      • ATP synthesis rates

      • Mitochondrial membrane potential

    • Correlation of functional outcomes with genotypes

  • Statistical analysis plan:

    • Calculation of odds ratios (OR) with 95% confidence intervals

    • Adjustment for relevant covariates

    • Stratified analyses to identify subgroup effects

    • Correlation analyses for continuous variables (e.g., Pearson correlation)

  • Integration with clinical data:

    • Detailed phenotyping of study participants

    • Correlation of polymorphisms with clinical manifestations

    • Longitudinal follow-up where possible to assess disease progression

Research has demonstrated that specific polymorphisms like rs41467651 T allele significantly increase gastric cancer risk (adjusted OR = 2.11, 95% CI = 1.25-3.55, P = 0.005), with particularly strong associations observed in females for rs28358278 G and rs2853826 T alleles .

What novel methodologies are being developed for studying MT-ND3 in mitochondrial research?

Recent methodological advances are expanding our ability to study MT-ND3 and related mitochondrial proteins:

  • Next-generation sequencing (NGS) applications:

    • Quantitative analysis of heteroplasmic mutant load by counting mtDNA reads

    • Deep sequencing approaches for detecting low-level heteroplasmy

    • Integration with bioinformatics pipelines using tools like Burrows-Wheeler Aligner and Genome Analysis Toolkit for variant identification

  • mRNA therapeutic delivery systems:

    • MITO-Porter technology for targeted delivery of therapeutic mRNAs to mitochondria

    • Design considerations for therapeutic mRNAs, including:

      • Codon optimization

      • Start codon modification (ATA to ATG)

      • PolyA tail considerations for translation efficiency

    • Validation through cellular uptake studies and intracellular trafficking analysis

  • Quantitative mutation analysis:

    • Amplification Refractory Mutation System (ARMS)-quantitative PCR for precise quantification of mutation rates

    • Design of common forward primers and mutation-specific reverse primers with strategic mismatches at the 3' terminal

    • Development of standard curves using mixed wild-type and mutant templates for accurate quantification

  • Therapeutic effect assessment:

    • Measurement of mitochondrial respiration in diseased cells after therapeutic intervention

    • Evaluation of heteroplasmy levels following transfection

    • Correlation analyses between mutation load and clinical manifestations

  • Protein engineering approaches:

    • Production of stabilized recombinant MT-ND3 variants with improved solubility

    • Introduction of affinity tags for enhanced purification and detection

    • Development of protein-based therapeutic delivery systems

These methodologies collectively offer new opportunities for understanding MT-ND3 biology and developing targeted interventions for mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.