Recombinant Neotoma lepida NADH-ubiquinone oxidoreductase chain 3 (MT-ND3)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Complex I

MT-ND3 is a core subunit of NADH dehydrogenase (Complex I), which catalyzes electron transfer from NADH to ubiquinone during oxidative phosphorylation . Key mechanistic roles include:

  • Participation in proton pumping across the mitochondrial membrane, contributing to the proton gradient for ATP synthesis .

  • Interaction with other hydrophobic subunits (e.g., ND4L, ND6) to stabilize Complex I’s transmembrane domain .

  • Pathogenic mutations in MT-ND3 disrupt electron transport, leading to mitochondrial disorders such as Leigh syndrome and MELAS .

Recombinant Production and Applications

Expression systems for Neotoma lepida MT-ND3 utilize E. coli due to its cost-effectiveness and scalability . Notable production details:

  • Yield: Optimized for research-grade quantities (0.1–1.0 mg/mL post-reconstitution) .

  • Applications:

    • SDS-PAGE analysis to study protein purity and stability .

    • Functional assays to investigate Complex I assembly defects in mitochondrial diseases .

  • Limitations: Not for human therapeutic use due to potential immunogenicity and lack of post-translational modifications .

Clinical and Research Implications

  • Disease models: Recombinant MT-ND3 enables in vitro studies of mutations linked to Leigh syndrome (e.g., m.10158T>C) .

  • Drug discovery: Used to screen small molecules targeting Complex I dysfunction in neurodegenerative diseases .

  • Comparative studies: Sequence variations between species (e.g., birds, turtles) provide evolutionary insights into mitochondrial genome adaptations .

Limitations and Future Directions

  • Species specificity: Structural differences between Neotoma lepida and human MT-ND3 may limit translational relevance .

  • Research gaps: Further studies are needed to map its interaction sites within Complex I and assess cryo-EM compatibility .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest briefly centrifuging this vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
MT-ND3; MTND3; NADH3; ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Neotoma lepida (Desert woodrat)
Target Names
Target Protein Sequence
MNMLLTMLTNITLSTLLISIAFWLPQLNIYTEKANPYECGFDPMSSARLPFSMKFFLVAI TFLLFDLEIALLLPIPWAIQVKDINTMTLTAFILVSILALGLAYEWTQKGLEWTE
Uniprot No.

Target Background

Function
The core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) catalyzes electron transfer from NADH through the respiratory chain, utilizing ubiquinone as an electron acceptor. This subunit is crucial for the catalytic activity of Complex I.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND3 and what is its function in Neotoma lepida?

MT-ND3 (NADH-ubiquinone oxidoreductase chain 3) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that belongs to the minimal assembly required for catalysis. In Neotoma lepida (Desert woodrat), as in other mammals, this protein functions in the transfer of electrons from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor . The protein is encoded by the mitochondrial gene MT-ND3 (also known as MTND3, NADH3, or ND3) . As a critical component of the electron transport chain, MT-ND3 plays an essential role in cellular energy production and mitochondrial function in Desert woodrats.

What is the amino acid sequence and structural characteristics of Neotoma lepida MT-ND3?

The amino acid sequence of Neotoma lepida MT-ND3 is: "MNmLLTmLTNITLSTLLISIAFWLPQLNIYTEKANPYECGFDPMSSARLPFSMKFFLVAITFLLFDLEIALLLPIPWAIQVKDINTMTLTAFILVSILALGLAYEWTQKGLEWTE" . The protein spans the expression region 1-115 and contains hydrophobic regions characteristic of membrane-embedded proteins. MT-ND3 is a relatively small subunit of Complex I but plays a crucial role in the assembly and function of the respiratory chain. The protein's structure features transmembrane domains that anchor it within the inner mitochondrial membrane, positioning it appropriately for participation in electron transfer activities.

How should Neotoma lepida MT-ND3 recombinant protein be stored and handled for optimal stability?

For optimal stability, recombinant Neotoma lepida MT-ND3 protein should be stored at -20°C, and for extended storage, conserved at -20°C or -80°C . Working aliquots can be maintained at 4°C for up to one week . The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for this specific protein . It is important to note that repeated freezing and thawing cycles should be avoided as they can lead to protein degradation and loss of activity . When working with the protein, researchers should consider preparing small aliquots during initial thawing to minimize freeze-thaw cycles and maintain protein integrity throughout experimental procedures.

What purification methods are most effective for isolating recombinant Neotoma lepida MT-ND3?

Purification of recombinant Neotoma lepida MT-ND3 typically requires a multi-step approach to achieve high purity. Affinity chromatography using a tag system (His-tag, GST, or other fusion tags determined during the production process ) provides an efficient initial purification step. This can be followed by size exclusion chromatography to separate the protein from aggregates and other molecular weight contaminants. Ion exchange chromatography may be employed as an intermediate or final step to remove proteins with different charge properties. For membrane proteins like MT-ND3, detergent selection is critical during purification to maintain protein stability and native conformation. Typical detergents include mild non-ionic options such as DDM (n-dodecyl β-D-maltoside) or digitonin, which effectively solubilize membrane proteins while preserving their structure and function.

What are the validated applications for recombinant Neotoma lepida MT-ND3 in research?

Recombinant Neotoma lepida MT-ND3 has several validated research applications. It can be used in enzyme-linked immunosorbent assays (ELISA) for quantitative detection and antibody validation . The protein serves as a valuable tool in structural biology studies to understand the architecture and assembly of Complex I. In functional assays, it can help investigate electron transport chain activity and mitochondrial function. The recombinant protein is also useful for generating and characterizing antibodies against MT-ND3, which can subsequently be used in techniques like immunohistochemistry (IHC) and Western blotting (WB) . Additionally, it serves as a standard in comparative studies examining differences in MT-ND3 across species or investigating the effects of mutations on protein function and stability.

What is known about MT-ND3 variations among different woodrat species in the Neotoma genus?

The Neotoma genus comprises several woodrat species, including the desert woodrat complex of the Neotoma lepida group, which consists of continental species (N. lepida and N. devia) and island species (N. anthonyi, N. martinensis, N. bryanti, and N. bunkeri) . Mitochondrial DNA analyses, particularly of genes like cytochrome-b, have been employed to understand the evolutionary relationships among these species . While specific comparative data on MT-ND3 across all Neotoma species is limited in the provided search results, molecular genetic approaches have been used to examine over 1000 individuals for mitochondrial variations . These studies help elucidate how mitochondrial genes, including potentially MT-ND3, have evolved within this genus in response to different ecological conditions, particularly considering the diverse habitats of continental versus island populations.

How can recombinant Neotoma lepida MT-ND3 be used to study mitochondrial disease models?

Recombinant Neotoma lepida MT-ND3 provides a valuable tool for investigating mitochondrial disease mechanisms through comparative and functional studies. Mutations in human MT-ND3, such as the m.10197G>A mutation, can cause serious mitochondrial disorders including adult-onset Leigh syndrome and Leber hereditary optic neuropathy with dystonia . Researchers can use recombinant wild-type and mutant versions of MT-ND3 to study how specific mutations affect protein folding, stability, and function. By comparing the biochemical properties of wild-type Neotoma lepida MT-ND3 with mutant variants corresponding to known human pathogenic mutations, researchers can gain insights into the molecular mechanisms underlying mitochondrial diseases. Such studies might involve reconstitution experiments, electron transport chain activity assays, protein-protein interaction analyses, and structural studies to elucidate how mutations disrupt normal Complex I function.

What techniques can be employed to study interactions between MT-ND3 and other components of Complex I?

Several advanced techniques can be employed to study the interactions between MT-ND3 and other components of Complex I:

  • Crosslinking coupled with mass spectrometry (XL-MS): This technique can identify amino acid residues that are in close proximity between MT-ND3 and other subunits of Complex I.

  • Cryo-electron microscopy (Cryo-EM): Provides high-resolution structural information about the entire Complex I, showing the position and interactions of MT-ND3 within the larger assembly.

  • Co-immunoprecipitation (Co-IP): Using antibodies against MT-ND3 to pull down the protein along with its interacting partners, followed by identification using mass spectrometry.

  • Blue Native PAGE: Allows analysis of intact Complex I and can be combined with second-dimension SDS-PAGE to identify individual subunits and their stoichiometry.

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST): Quantifies binding affinities between MT-ND3 and other purified Complex I components.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies regions of MT-ND3 that are involved in protein-protein interactions by measuring the rate of hydrogen exchange.

These techniques provide complementary information about the structural and functional interactions of MT-ND3 within the Complex I machinery.

How can site-directed mutagenesis of recombinant Neotoma lepida MT-ND3 be used to investigate structure-function relationships?

Site-directed mutagenesis of recombinant Neotoma lepida MT-ND3 offers a powerful approach to investigate structure-function relationships within this critical mitochondrial protein. By introducing specific amino acid substitutions that correspond to conserved residues, researchers can determine which regions are essential for proper folding, complex assembly, and electron transport activity. The methodology involves:

  • Identification of target residues: Using sequence alignments across species, known human disease mutations , and structural information to identify residues of interest.

  • Mutagenesis protocol: Employing PCR-based methods to introduce specific mutations into the MT-ND3 coding sequence within an appropriate expression vector.

  • Expression and purification: Producing the mutant proteins using the same expression system as the wild-type protein to ensure comparable results .

  • Functional assays: Measuring electron transport activity, NADH oxidation rates, and ubiquinone reduction to assess functional consequences.

  • Structural analysis: Using techniques like circular dichroism or limited proteolysis to determine if mutations affect protein folding or stability.

  • Complex I assembly analysis: Determining whether mutant MT-ND3 can properly incorporate into Complex I using blue native PAGE or similar techniques.

This approach can reveal the functional significance of specific residues and domains within MT-ND3, contributing to our understanding of both basic mitochondrial biology and the pathophysiology of mitochondrial diseases.

What are the main challenges in expressing and purifying membrane proteins like MT-ND3, and how can they be overcome?

Expressing and purifying membrane proteins like MT-ND3 presents several significant challenges:

ChallengeSolution
Low expression levelsOptimize codon usage for the expression host; use strong, inducible promoters; consider fusion partners that enhance expression
Protein misfoldingExpress at lower temperatures (16-20°C); use specialized host strains designed for membrane proteins; employ chaperone co-expression systems
Toxicity to host cellsUse tightly controlled inducible expression systems; consider cell-free expression systems for highly toxic proteins
Inclusion body formationOptimize induction conditions (lower IPTG concentration, lower temperature); develop effective refolding protocols if using inclusion bodies
Extraction from membranesScreen multiple detergents for optimal solubilization; consider novel solubilization agents like SMALPs (styrene-maleic acid lipid particles) or nanodiscs
Maintaining native conformationUse mild detergents; include lipids during purification; consider amphipol exchange for long-term stability
Protein heterogeneityEmploy size exclusion chromatography as a final purification step; use analytical techniques (DLS, SEC-MALS) to assess homogeneity
Low yieldsScale up culture volumes; optimize each purification step; consider alternative expression systems like yeast, insect cells, or mammalian cells

These strategies help overcome the inherent difficulties in working with hydrophobic membrane proteins like MT-ND3, ultimately yielding functional protein suitable for downstream applications.

How can researchers troubleshoot loss of activity in recombinant MT-ND3 during experimental procedures?

Loss of activity in recombinant MT-ND3 during experimental procedures is a common challenge that requires systematic troubleshooting. Researchers should evaluate storage conditions, as improper temperature management or excessive freeze-thaw cycles can cause protein degradation . The protein buffer composition should be assessed, potentially requiring optimization of salt concentration, pH, and the addition of stabilizing agents like glycerol . Degradation by proteases can be addressed by adding protease inhibitors during all experimental steps. For membrane proteins like MT-ND3, detergent selection is critical—too harsh detergents can denature the protein, while insufficient detergent can lead to aggregation. Researchers should monitor protein aggregation using techniques like dynamic light scattering or size exclusion chromatography, and consider adding lipids to stabilize the native conformation. Activity assays should be performed immediately after purification to establish a baseline, and aliquoting the protein to minimize freeze-thaw cycles is recommended . For functional studies, reconstitution into liposomes or nanodiscs may better preserve the protein's native environment and activity.

How can research on Neotoma lepida MT-ND3 contribute to understanding evolutionary adaptations in desert mammals?

Research on Neotoma lepida MT-ND3 can significantly contribute to understanding evolutionary adaptations in desert mammals through several approaches. Comparative genomic studies between Neotoma lepida (desert woodrat) and closely related species living in different environments can reveal adaptive changes in mitochondrial genes . Desert woodrats face extreme thermal challenges and limited water availability, potentially driving selection pressure on genes involved in energy metabolism. MT-ND3, as a component of Complex I, may show adaptive mutations that optimize electron transport efficiency under thermal stress or that reduce reactive oxygen species production. Functional studies comparing the biochemical properties of MT-ND3 from desert-adapted woodrats versus non-desert species could identify differences in catalytic efficiency, thermal stability, or response to oxidative stress. Additionally, population genetic studies within Neotoma lepida across different desert environments might reveal ongoing selection on MT-ND3, particularly in populations facing different thermal regimes or dietary challenges, given the species' ability to consume toxic plants containing compounds that might affect mitochondrial function.

What role might MT-ND3 play in the metabolic adaptations of Neotoma lepida to oxidative stress and diet-induced challenges?

MT-ND3's potential role in metabolic adaptations of Neotoma lepida to oxidative stress and diet-induced challenges is a fascinating area of research with implications for understanding mammalian metabolic resilience. Desert woodrats are known for their ability to consume plants containing high levels of toxic compounds, which places significant metabolic stress on their detoxification pathways. Recent research indicates that oxalate homeostasis is affected by microbiome and diet interactions, with changes in microbial metabolic output and hepatic gene expression . In this context, MT-ND3 and other mitochondrial proteins may play critical roles in maintaining energy homeostasis during detoxification processes. As a component of Complex I, MT-ND3 is at the nexus of cellular energy production and reactive oxygen species generation. Adaptations in this protein might allow desert woodrats to maintain mitochondrial function while handling increased oxidative stress from both environmental conditions and dietary toxins. Studying the response of MT-ND3 to dietary challenges in Neotoma lepida could provide insights into how mitochondrial function adapts to nutritional stress and toxin exposure, potentially revealing mechanisms of metabolic resilience that could inform human health research.

What emerging technologies could enhance our understanding of MT-ND3 structure and function in Neotoma lepida?

Emerging technologies that could significantly enhance our understanding of MT-ND3 structure and function in Neotoma lepida include advanced cryo-electron microscopy (cryo-EM) techniques that now achieve near-atomic resolution of membrane protein complexes, potentially revealing species-specific structural features of MT-ND3 within Complex I. AlphaFold and other AI-driven protein structure prediction tools could generate accurate models of Neotoma lepida MT-ND3, especially when combined with experimental validation. Single-molecule techniques such as FRET (Förster Resonance Energy Transfer) could track conformational changes during electron transport, providing dynamic insights not available from static structures. In vivo mitochondrial imaging using genetically encoded biosensors could monitor MT-ND3 function in real-time within living cells. CRISPR-Cas9 gene editing techniques adapted for mitochondrial DNA could enable precise manipulation of MT-ND3 in cellular models to study functional consequences of specific mutations. Integrative multi-omics approaches combining proteomics, metabolomics, and transcriptomics could place MT-ND3 function within broader cellular metabolic networks, particularly important when studying adaptations to environmental stressors. These technologies, employed together, would provide unprecedented insights into the structure, function, and physiological significance of MT-ND3 in desert woodrats.

How might systematic comparative analysis of MT-ND3 across Neotoma species inform our understanding of mitochondrial evolution and adaptation?

Systematic comparative analysis of MT-ND3 across Neotoma species has the potential to significantly advance our understanding of mitochondrial evolution and adaptation to diverse environments. The Neotoma genus comprises species inhabiting a range of ecological niches, from desert environments (N. lepida, N. devia) to island habitats (N. anthonyi, N. martinensis, N. bryanti, N. bunkeri) , providing a natural experiment in adaptation. A comprehensive study would involve sequencing MT-ND3 from multiple individuals across different Neotoma species and populations, analyzing selection signatures using dN/dS ratios and other evolutionary metrics to identify amino acid positions under positive selection. Combining this with ecological and physiological data could reveal correlations between specific MT-ND3 variants and environmental factors or metabolic traits. Reconstructing ancestral MT-ND3 sequences would allow researchers to trace the evolutionary trajectory of this gene within the genus. Experimental validation through recombinant expression of ancestral and extant MT-ND3 variants, followed by functional characterization, could directly test hypotheses about adaptive changes. This integrated approach would provide insights into how mitochondrial genes evolve in response to environmental challenges, potentially revealing molecular mechanisms underlying metabolic adaptation that could have broader implications for understanding climate change responses in mammals.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.