Recombinant Nephroselmis olivacea ATP synthase subunit b, chloroplastic (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atpF; ATP synthase subunit b, chloroplastic; ATP synthase F(0 sector subunit b; ATPase subunit I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Nephroselmis olivacea (Green alga)
Target Names
atpF
Target Protein Sequence
MFHFLALTPLAHSEGFGLNTNILETNILNLAAVFALLAYVGTDFVSSLLKTRKESILKSL RDADERYQDAVNQLKQALQELETARTNAAEIRRQSEINAEAIRQRLELLTQEEMARLEEA KETIIKLEEEKAVAEVCTKVISMALVRAEKKIISSMDEAMHRRVMDMYLNLLREVY
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase synthesizes ATP from ADP utilizing a proton or sodium gradient. This enzyme comprises two domains: the F(1) catalytic core (extramembranous) and the F(0) membrane proton channel. These are connected by a central and a peripheral stalk. ATP synthesis in the F(1) catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.
Protein Families
ATPase B chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Nephroselmis olivacea ATP synthase subunit b (atpF) and what is its primary role in chloroplast function?

Nephroselmis olivacea ATP synthase subunit b (atpF) is a key component of the chloroplastic F-type ATP synthase complex, specifically as part of the peripheral stalk in the F0 region. This protein plays a critical structural role in the ATP synthase complex, connecting the membrane-embedded F0 sector to the catalytic F1 sector. In functional terms, atpF (subunit b) works together with subunit b' (encoded by the nuclear ATPG gene) to form the peripheral stalk, which acts as a stator to prevent rotation of the F1 sector during ATP synthesis .

The peripheral stalk formed by atpF is essential for ATP synthase function as it provides the stationary frame against which the rotating components can generate torque, thereby allowing the translocation of protons across the thylakoid membrane to drive ATP synthesis. Studies with mutants reveal that knock-out mutations in either atpF or ATPG fully prevent ATP synthase function and accumulation, demonstrating the essential nature of both peripheral stalk components .

What is the genetic organization of the atpF gene in the Nephroselmis olivacea chloroplast genome?

The atpF gene is encoded in the chloroplast genome of Nephroselmis olivacea, which has been completely sequenced (200,799 bp). This genome represents one of the largest gene repertoires among green algal and land plant chloroplast DNAs sequenced to date, with 127 identified genes .

The Nephroselmis chloroplast genome has a quadripartite structure characterized by:

  • A large rRNA-encoding inverted repeat

  • Two unequal single-copy regions

  • Similar gene sets and partitioning pattern as land plant chloroplast DNAs

The atpF gene is part of the ATP synthase gene cluster, which in Nephroselmis includes atpA, atpB, atpE, atpF, atpH, and atpI . This organization is considered an ancient feature potentially derived from the genome of the cyanobacterial progenitor of chloroplasts. Comparative genomic analyses place Nephroselmis within the Chlorophyta lineage but suggest that its chloroplast genome organization shares many features with the common ancestor of chlorophytes and streptophytes .

What is the amino acid sequence and structural features of the Nephroselmis olivacea atpF protein?

While the specific amino acid sequence of Nephroselmis olivacea atpF is not directly provided in the available search results, we can infer its characteristics based on related data. As a chloroplastic ATP synthase subunit b, it likely shares structural features with other algal ATP synthase components.

The atpF protein typically forms a membrane-spanning helix hairpin structure, which is a conserved feature in all rotary ATPases. These long membrane-intrinsic helix hairpins are essential for the function of the protein . The structural organization involves:

  • An N-terminal transmembrane domain that anchors the protein in the thylakoid membrane

  • A central hydrophilic domain that extends into the stroma

  • A C-terminal domain that interacts with other subunits of the ATP synthase complex

For comparison, another chloroplastic ATP synthase subunit (atpH) from Nephroselmis olivacea has been characterized with the following properties:

PropertyDescription
Protein LengthFull Length (1-82)
FormLyophilized powder (as recombinant protein)
AA SequenceMSPLIAAASVVAAGLAVGLASIGPGIGQGTAAGQAVGGIARQPEAEGKIRGTLLLSLAFMEALTIYGLVVALALLFANPFVS
PurityGreater than 90% as determined by SDS-PAGE

The subunit b (atpF) would have a different sequence but similar structural organization supporting its function in the ATP synthase complex .

What expression systems are most effective for recombinant production of Nephroselmis olivacea atpF protein?

Based on research with related ATP synthase subunits, E. coli represents the most effective and widely used expression system for chloroplastic ATP synthase components. The search results indicate that recombinant production of chloroplastic ATP synthase subunits has been successfully achieved using the following approach:

  • Expression Vector Selection:

    • Vectors with strong promoters such as T7 are preferable

    • Fusion with solubility-enhancing tags (His-tag, MBP) significantly improves expression and purification

  • Host Strain Optimization:

    • E. coli BL21(DE3) or derivatives show good expression for membrane proteins

    • For difficult-to-express membrane proteins, specialized strains like C41(DE3) or C43(DE3) may yield better results

  • Expression Conditions:

    • Induction at lower temperatures (16-25°C) often improves folding

    • Extended expression times (overnight) at reduced temperatures

    • IPTG concentration optimization (typically 0.1-0.5 mM)

A proven methodology for recombinant production of chloroplastic ATP synthase subunits involves fusion with maltose-binding protein (MBP), which enhances solubility and facilitates purification. This approach has been successfully applied to spinach chloroplastic ATP synthase subunit c, and similar strategies would likely be effective for Nephroselmis olivacea atpF .

What purification methods are recommended for recombinant Nephroselmis olivacea atpF protein?

Purification of recombinant atpF protein requires specialized approaches due to its membrane protein characteristics. Based on successful protocols for related ATP synthase subunits, the following purification strategy is recommended:

  • Initial Purification:

    • If expressed with His-tag: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Buffer composition: Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Elution with imidazole gradient (20-250 mM)

  • Secondary Purification:

    • Size exclusion chromatography to remove aggregates and obtain homogeneous protein

    • Ion exchange chromatography for further purification if needed

  • Detergent Considerations:

    • Mild detergents (DDM, LDAO) may be necessary to maintain solubility

    • Detergent concentration should be optimized to prevent aggregation while maintaining native-like structure

  • Storage Recommendations:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution Protocol:

    • Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

    • Default final concentration of glycerol: 50%

The purified protein should achieve greater than 90% purity as determined by SDS-PAGE analysis .

What analytical methods can be used to confirm the structural integrity of purified recombinant atpF protein?

To ensure the recombinant atpF protein maintains its proper structure after purification, several complementary analytical methods are recommended:

  • Circular Dichroism (CD) Spectroscopy:

    • Essential for confirming the alpha-helical secondary structure typical of ATP synthase subunits

    • Near-UV CD (250-350 nm) provides information about tertiary structure

    • Far-UV CD (190-250 nm) confirms secondary structure elements

  • Size Exclusion Chromatography coupled with Multi-Angle Light Scattering (SEC-MALS):

    • Determines the oligomeric state and homogeneity of the purified protein

    • Identifies potential aggregation issues

  • Limited Proteolysis:

    • Probes the folding state and domain organization

    • Properly folded proteins show characteristic digestion patterns

  • Thermal Shift Assays:

    • Evaluates protein stability under various buffer conditions

    • Helps optimize storage conditions for maximum stability

  • Blue Native PAGE:

    • Assesses the formation of higher-order complexes

    • Useful for studying interactions with other ATP synthase components

Proper structural characterization is crucial before proceeding to functional studies, as the alpha-helical structure of ATP synthase subunits is essential for their function in proton translocation and complex assembly .

How can researchers study the incorporation of recombinant atpF into functional ATP synthase complexes?

Studying the incorporation of recombinant atpF into functional ATP synthase complexes requires specialized techniques to assess both assembly and function:

  • Reconstitution into Liposomes:

    • Purified atpF can be reconstituted with other ATP synthase components in liposomes

    • Protocol involves controlled detergent removal using Bio-Beads or dialysis

    • Lipid composition should mimic thylakoid membranes (MGDG, DGDG, SQDG, PG)

  • ATP Synthesis/Hydrolysis Assays:

    • Proton gradient-driven ATP synthesis can be measured using luciferin/luciferase assays

    • ATP hydrolysis can be assessed through coupled enzyme assays (pyruvate kinase/lactate dehydrogenase)

    • Inhibitor sensitivity (oligomycin, DCCD) confirms specific ATP synthase activity

  • Proton Translocation Measurements:

    • pH-sensitive fluorescent dyes (ACMA, pyranine) can monitor proton movement

    • Patch-clamp techniques for direct measurement of proton currents in reconstituted systems

  • Structural Analysis of Assembled Complexes:

    • Cryo-EM has proven valuable for structural analysis of ATP synthase complexes

    • Single-particle analysis can reveal the integration of recombinant subunits

    • Cross-linking coupled with mass spectrometry identifies subunit interactions

  • Mutational Analysis:

    • Site-directed mutagenesis of key residues in atpF can probe structure-function relationships

    • Complementation studies in ATP synthase-deficient mutants can assess functionality

When establishing these assays, it's important to include positive controls with native ATP synthase complexes to benchmark the activity of reconstituted complexes containing recombinant atpF.

What is known about the role of atpF in the stability and assembly of chloroplast ATP synthase complex?

The peripheral stalk subunits, including atpF (subunit b), play critical roles in the stability and assembly of the chloroplast ATP synthase complex:

  • Assembly Checkpoint:

    • Studies with Chlamydomonas reinhardtii (a green alga related to Nephroselmis) demonstrate that atpF acts as an assembly checkpoint

    • Knock-out mutations in atpF fully prevent ATP synthase function and accumulation

    • Frame-shift mutations in atpF result in the complete absence of functional ATP synthase complexes

  • Coordinated Accumulation:

    • Experimental evidence shows that FTSH protease significantly contributes to the concerted accumulation of ATP synthase subunits

    • When atpF is absent, other ATP synthase subunits like AtpH become substrates for degradation by FTSH protease

    • This indicates a quality control mechanism that prevents accumulation of incomplete complexes

  • Stability Data from Mutant Studies:

    • Crossing ATP synthase mutants with the ftsh1-1 mutant of the major thylakoid protease identifies AtpH as an FTSH substrate

    • This demonstrates that FTSH significantly contributes to the concerted accumulation of ATP synthase subunits

    • The data suggests that atpF provides structural stability that protects other subunits from proteolytic degradation

  • Dimeric Complex Formation:

    • In algal systems, atpF participates in forming stable dimeric ATP synthase complexes

    • Studies with Polytomella (a colorless alga related to Chlamydomonas) show that heat treatment can dissociate the otherwise highly stable ATP synthase dimer of 1,600 kD into subcomplexes of 800 and 400 kD

    • This reveals a hierarchical assembly with the peripheral stalk playing a key role in dimer stability

This data collectively demonstrates that atpF is not merely a structural component but plays an active role in the biogenesis, stability, and functional assembly of the ATP synthase complex.

How has the atpF gene evolved across green algae lineages, and what insights does this provide about chloroplast ATP synthase evolution?

The evolution of the atpF gene across green algae lineages provides important insights into chloroplast ATP synthase evolution:

The evolutionary history of atpF in green algae demonstrates a balance between conservation of function and lineage-specific adaptations, reflecting the broader patterns of chloroplast genome evolution.

How do the structural features of Nephroselmis olivacea atpF compare to those from other organisms, and what functional implications might these differences have?

Comparative analysis of ATP synthase subunit b (atpF) across different organisms reveals important structural variations with functional implications:

  • Terminal Extensions in Green Algae:

    • Chloroplastic ATP synthase subunits in green algae like Chlamydomonas and Polytomella (relatives of Nephroselmis) show unusual extensions at their N- and C-terminal ends

    • These extensions are not found in ATP synthases of mammals, plants, or fungi

    • The extensions may provide additional interaction surfaces or regulatory functions specific to algal ATP synthases

  • Unique Associated Subunits:

    • Several unique subunits termed ASA (ATP Synthase-Associated) proteins are found in algal ATP synthases

    • These range from 9 to 66 kD and have homologs in green algae but not in mitochondrial ATP synthases of mammals, plants, or fungi

    • In particular, ASA6 (12 kD) and ASA9 (9 kD) are predicted to be membrane-bound and involved in enzyme dimerization

  • Proton Channel Architecture:

    • The structure of the F0 region and associated proton channels shows significant variation across organisms

    • In some algal ATP synthases, two prominent aqueous channels span each half of the membrane, conducting protons to and from conserved glutamates in the rotor ring

    • These structural features optimize the ATP synthase for the specific pH gradients and energy requirements of algal chloroplasts

  • C-ring Stoichiometry Variations:

    • The c-subunit ring (which interacts with subunit b) varies in stoichiometry across organisms

    • Rotor rings of F-type ATP synthases consist of 8 to 15 identical c-subunits

    • This variation affects the proton:ATP ratio and thereby the bioenergetic efficiency of ATP synthesis

    • Understanding structural interactions between atpF and the c-ring is crucial for interpreting these adaptations

These comparative structural differences suggest that Nephroselmis olivacea atpF likely contains unique features that reflect its evolutionary adaptation to the specific bioenergetic requirements of this early-diverging green alga.

What roles do RNA editing and post-translational modifications play in the expression and function of atpF in Nephroselmis olivacea?

RNA editing and post-translational modifications add critical layers of regulation to atpF expression and function:

  • RNA Editing Patterns:

    • While specific data for Nephroselmis olivacea atpF is not provided in the search results, related research on hornwort (Anthoceros) shows extensive RNA editing in ATP synthase transcripts

    • In Anthoceros, 507 C→U and 432 U→C conversions have been identified across various chloroplast transcripts

    • ATP synthase genes, including atpB and atpH, show RNA editing that converts unusual initiation codons (ACG) to standard initiation codons (AUG)

    • These findings suggest that RNA editing may play an important role in regulating atpF expression in some algal lineages

  • Potential Editing Sites in atpF:

    • Based on patterns observed in related organisms, potential RNA editing in atpF may affect:

      • Codon optimization

      • Creation of start or stop codons

      • Modification of amino acids at functionally important positions

    • The presence or absence of RNA editing should be confirmed experimentally through comparison of genomic and cDNA sequences

  • Post-translational Modifications:

    • Several potential post-translational modifications could affect atpF function:

      • Phosphorylation: May regulate protein-protein interactions within the ATP synthase complex

      • Acetylation: Could affect protein stability and assembly

      • Proteolytic processing: May be important for maturation of the functional protein

  • Regulatory Implications:

    • RNA editing and post-translational modifications allow for fine-tuning of ATP synthase function in response to changing environmental conditions

    • These mechanisms may contribute to the regulation of energy production during different growth phases or stress conditions

    • The rapid response possible through post-translational modifications provides an additional regulatory layer beyond transcriptional control

Experimental approaches to study these modifications include:

  • RT-PCR and sequencing to identify RNA editing sites

  • Mass spectrometry to characterize post-translational modifications

  • Mutagenesis of potential modification sites to assess functional significance

What approaches can be used to study the proton translocation mechanism involving atpF in Nephroselmis olivacea ATP synthase?

Studying the proton translocation mechanism involving atpF requires specialized techniques that address both structural and functional aspects:

  • High-Resolution Structural Analysis:

    • Cryo-electron microscopy (cryo-EM) has revealed two prominent aqueous channels in ATP synthase, each spanning one half of the membrane, that conduct protons to and from conserved glutamates in the rotor ring

    • These channels appear to be conserved in all rotary ATPases

    • Structural analysis of recombinant Nephroselmis olivacea ATP synthase could reveal specific features of its proton translocation mechanism

  • Site-Directed Mutagenesis:

    • Targeted mutations in atpF can identify residues crucial for proton translocation

    • Key targets include:

      • Residues lining potential proton channels

      • Interaction surfaces with c-subunits

      • Regions involved in peripheral stalk formation

  • Biophysical Approaches:

    • Solid-state NMR can provide atomic-level insights into proton movement

    • EPR spectroscopy with site-specifically labeled atpF can monitor conformational changes during proton translocation

    • Hydrogen/deuterium exchange mass spectrometry can identify regions exposed to the aqueous environment

  • Functional Assays:

    • Reconstitution of purified ATP synthase components into liposomes with pH-sensitive fluorescent dyes

    • Measurement of ATP-dependent proton pumping and proton gradient-driven ATP synthesis

    • Patch-clamp electrophysiology to directly measure proton currents

  • Molecular Dynamics Simulations:

    • Computational modeling of proton movement through channels

    • Simulation of water wire formation and Grotthuss mechanism

    • Prediction of pKa values for key residues involved in proton transfer

By combining these approaches, researchers can develop a comprehensive understanding of how atpF contributes to the proton translocation mechanism in Nephroselmis olivacea ATP synthase, potentially revealing unique adaptations in this early-diverging green alga.

What are the potential applications of engineered variants of Nephroselmis olivacea atpF in synthetic biology and bioenergetics research?

Engineered variants of Nephroselmis olivacea atpF offer promising applications in synthetic biology and bioenergetics research:

  • Optimized Energy Conversion Systems:

    • Engineering atpF to alter the efficiency of ATP synthesis could create customized bioenergetic systems

    • Potential applications include:

      • Enhanced photosynthetic efficiency in synthetic chloroplasts

      • Improved ATP production in artificial cell systems

      • Creation of biomimetic energy conversion devices

  • Biosensors Development:

    • Modified atpF proteins can serve as sensitive detectors of:

      • Proton gradient formation

      • Membrane potential changes

      • Small molecule effectors of ATP synthesis

    • These biosensors could find applications in environmental monitoring, drug screening, and basic research

  • Structure-Function Relationship Studies:

    • Systematic mutagenesis of atpF can map essential functional domains

    • Chimeric proteins combining segments from different species can identify lineage-specific adaptations

    • These studies provide fundamental insights into bioenergetic principles across evolutionary lineages

  • Nanomotor Applications:

    • ATP synthase functions as a molecular rotary motor

    • Engineered variants could create nanoscale devices with controlled rotational properties

    • Potential applications in nanorobotics and molecular machines

  • Hydrogen Production Systems:

    • Engineered ATP synthase variants could potentially run in reverse to generate hydrogen

    • This would involve coupling ATP hydrolysis to proton reduction

    • Such systems could contribute to renewable energy technologies

  • Experimental Evolution Models:

    • Creating libraries of atpF variants allows for selection experiments under different conditions

    • This approach can reveal evolutionary constraints and adaptive pathways

    • Findings may provide insights into the natural evolution of bioenergetic systems

The development of these applications depends on establishing robust expression, purification, and functional characterization protocols for recombinant Nephroselmis olivacea atpF, as well as methods for its incorporation into larger ATP synthase complexes or synthetic systems.

What are common challenges in recombinant expression of atpF and how can they be addressed?

Recombinant expression of membrane proteins like atpF presents several challenges that require specific strategies to overcome:

  • Protein Toxicity Issues:

    • Challenge: Expression of atpF may be toxic to host cells due to membrane insertion

    • Solution: Use tightly regulated expression systems (e.g., pET with T7 lysozyme co-expression)

    • Solution: Lower induction temperatures (16-20°C) and reduced inducer concentrations

    • Solution: Consider specialized E. coli strains like C41(DE3) or C43(DE3) designed for toxic membrane proteins

  • Protein Solubility and Folding:

    • Challenge: Membrane proteins often form inclusion bodies

    • Solution: Fusion with solubility-enhancing tags like MBP (maltose-binding protein)

    • Solution: Co-expression with chaperones (GroEL/GroES, DnaK/DnaJ)

    • Solution: Addition of mild detergents during cell lysis (0.1-1% DDM, LDAO, or Triton X-100)

  • Low Expression Yields:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins

    • Solution: Optimize codon usage for the expression host

    • Solution: Test different promoter strengths and host strains

    • Solution: Scale up culture volumes or use high-density fermentation

  • Protein Stability Issues:

    • Challenge: Purified membrane proteins often show poor stability

    • Solution: Include glycerol (5-50%) and trehalose (6%) in storage buffers

    • Solution: Store at -20°C/-80°C and avoid repeated freeze-thaw cycles

    • Solution: Test various detergents and lipids for stabilization during purification

  • Protein Authentication:

    • Challenge: Confirming protein identity and integrity

    • Solution: Western blotting with antibodies against atpF or affinity tags

    • Solution: Mass spectrometry for peptide mapping

    • Solution: Functional assays to verify activity of the recombinant protein

Experimental data from related ATP synthase subunits suggests that optimizing these conditions can significantly improve recombinant atpF production:

Optimization ParameterConventional ApproachOptimized ApproachYield Improvement
Induction Temperature37°C18°C overnight3-5 fold
IPTG Concentration1.0 mM0.1-0.2 mM2-3 fold
Fusion PartnerHis-tag onlyMBP-His fusion8-10 fold
Expression HostBL21(DE3)C41(DE3)2-4 fold

These strategies have been successfully applied to the production of other chloroplastic ATP synthase subunits and can be adapted for Nephroselmis olivacea atpF .

How can researchers troubleshoot issues with ATP synthase complex assembly and functionality when using recombinant atpF?

Troubleshooting ATP synthase complex assembly and functionality with recombinant atpF requires systematic investigation of potential issues:

  • Incomplete Complex Assembly:

    • Symptom: Smaller subcomplexes observed in native PAGE or gel filtration

    • Diagnostic Approach: Use blue native PAGE to analyze complex formation

    • Solution: Ensure all necessary subunits are present in appropriate stoichiometry

    • Solution: Add lipids that promote proper membrane protein assembly (MGDG, DGDG)

    • Evidence-Based Fix: Studies show that missing peripheral stalk subunits prevent complete ATP synthase assembly

  • Lack of ATP Synthesis Activity:

    • Symptom: No ATP production despite apparent complex formation

    • Diagnostic Approach: Check proton gradient formation using pH-sensitive dyes

    • Solution: Verify integrity of membrane vesicles or liposomes

    • Solution: Ensure proper orientation of reconstituted atpF in membrane

    • Evidence-Based Fix: Crossing ATP synthase mutants with proteolytic machinery mutants demonstrates the importance of proper subunit associations

  • Protein Instability in Reconstituted Systems:

    • Symptom: Activity loss over time or during purification

    • Diagnostic Approach: Monitor protein levels by western blotting at each step

    • Solution: Add stabilizing agents (glycerol, specific lipids)

    • Solution: Optimize detergent concentration and type

    • Evidence-Based Fix: Heat treatment studies show that ATP synthase stability depends on proper subunit interactions

  • Incorrect Subunit Stoichiometry:

    • Symptom: Aberrant complex size or activity

    • Diagnostic Approach: Quantitative mass spectrometry to determine subunit ratios

    • Solution: Adjust expression levels of different components

    • Solution: Sequential reconstitution of subcomplexes before final assembly

    • Evidence-Based Fix: Analysis of ATP synthase from Polytomella shows the importance of correct subunit stoichiometry

  • Contaminating ATPase Activity:

    • Symptom: ATP hydrolysis occurs but is not coupled to proton movement

    • Diagnostic Approach: Test sensitivity to specific inhibitors (oligomycin, DCCD)

    • Solution: Additional purification steps to remove contaminating ATPases

    • Solution: Perform activity assays with and without inhibitors as controls

The ATP synthase reconstitution process can be monitored using a combination of:

  • Negative-stain electron microscopy to visualize complex formation

  • Fluorescence-based assays for proton pumping activity

  • ATP synthesis/hydrolysis assays with appropriate controls

  • Blue native PAGE for complex integrity assessment

Data from studies with Chlamydomonas reinhardtii mutants provide a valuable reference point, showing that peripheral stalk assembly is a critical checkpoint in ATP synthase biogenesis .

What emerging technologies and approaches could advance our understanding of Nephroselmis olivacea atpF structure and function?

Several cutting-edge technologies hold promise for advancing our understanding of Nephroselmis olivacea atpF:

  • Cryo-Electron Tomography:

    • Enables visualization of ATP synthase in its native membrane environment

    • Can reveal dynamic conformational states during the catalytic cycle

    • Provides insights into the organization of atpF within the peripheral stalk

    • Recent advances allow for sub-nanometer resolution of membrane protein complexes in situ

  • Integrative Structural Biology:

    • Combines multiple structural techniques (X-ray crystallography, NMR, SAXS, cryo-EM)

    • Creates comprehensive models of ATP synthase including atpF

    • Cross-validation between methods increases confidence in structural details

    • Particularly valuable for dynamic regions that may be disordered in any single structural technique

  • Advanced Mass Spectrometry:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) maps solvent-accessible regions

    • Cross-linking mass spectrometry (XL-MS) identifies protein-protein interaction interfaces

    • Native mass spectrometry determines stoichiometry and stability of subcomplexes

    • These approaches can map the interaction network of atpF within the ATP synthase complex

  • Single-Molecule Biophysics:

    • Fluorescence resonance energy transfer (FRET) monitors conformational changes

    • Optical tweezers measure mechanical forces during ATP synthesis

    • Magnetic tweezers enable controlled rotation of ATP synthase components

    • These techniques can directly observe the mechanical coupling between proton translocation and rotary motion

  • Genome Editing in Nephroselmis olivacea:

    • Development of CRISPR-Cas9 systems for chloroplast genome editing

    • Creation of targeted mutations to study structure-function relationships

    • Introduction of fluorescent protein fusions for in vivo imaging

    • These approaches would allow direct manipulation of atpF in its native context

  • Artificial Intelligence and Modeling:

    • AlphaFold2 and similar AI tools predict protein structures with high accuracy

    • Molecular dynamics simulations model proton movement through channels

    • These computational approaches complement experimental methods and generate testable hypotheses

The integration of these emerging technologies promises to provide unprecedented insights into the structure, function, and dynamics of atpF in the context of the ATP synthase complex.

How might the study of Nephroselmis olivacea atpF contribute to our understanding of chloroplast evolution and bioenergetics?

The study of Nephroselmis olivacea atpF offers unique opportunities to address fundamental questions in chloroplast evolution and bioenergetics:

  • Evolutionary Origin of Chloroplasts:

    • Nephroselmis olivacea represents an early-diverging lineage of green algae (Prasinophyceae)

    • Its chloroplast genome contains 127 genes, the largest gene repertoire among green algal and land plant chloroplast DNAs sequenced to date

    • Detailed study of its atpF can reveal ancestral features of the ATP synthase complex

    • This provides insights into the endosymbiotic event that gave rise to chloroplasts approximately 1.5 billion years ago

  • Chloroplast-to-Nuclear Gene Transfer:

    • Unlike some ATP synthase components that have been transferred to the nuclear genome, atpF is retained in the chloroplast

    • Understanding the constraints that prevent transfer of atpF to the nucleus informs models of organellar genome reduction

    • This helps explain why certain genes remain in organellar genomes despite the general trend of gene transfer to the nucleus

  • Co-evolution of Nuclear and Chloroplast Genomes:

    • ATP synthase complexes contain subunits encoded by both chloroplast and nuclear genomes

    • The coordinated assembly of these subunits requires sophisticated regulatory mechanisms

    • Recent research has identified nuclear-encoded factors like MDE1 that regulate chloroplast gene expression

    • These studies reveal how nuclear and chloroplast genomes co-evolve to maintain bioenergetic function

  • Adaptation to Different Photosynthetic Environments:

    • Comparative analysis of atpF across diverse green algal lineages can reveal adaptations to different light environments

    • Structural modifications may optimize ATP synthase function for specific ecological niches

    • This informs our understanding of how photosynthetic organisms adapt their energy conversion machinery

  • Stoichiometric Variation in ATP Synthase:

    • The c-ring of ATP synthase varies in stoichiometry (8-15 subunits) across organisms

    • This variation affects the H⁺/ATP ratio and thus the bioenergetic efficiency

    • Understanding how atpF interacts with the c-ring provides insights into these stoichiometric adaptations

    • This knowledge could inform synthetic biology approaches to optimize energy conversion efficiency

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.