Recombinant Nephroselmis olivacea Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Genomic and Evolutionary Context

cemA is part of the chloroplast genome of Nephroselmis olivacea, which retains ancestral features like a quadripartite structure (Large Single-Copy, Small Single-Copy, and Inverted Repeat regions) . Notable genomic insights:

  • Gene Cluster: Shares conserved clusters with land plants (e.g., ycf4-cemA-petA) .

  • Unique Features: Co-occurs with bacterial-division genes (e.g., ftsI, ftsW) in Nephroselmis, suggesting evolutionary retention of chloroplast division machinery .

Functional Insights

While cemA’s exact role remains under investigation, studies propose:

  • Membrane Dynamics: Potential involvement in chloroplast envelope integrity and ion transport .

  • Evolutionary Significance: Retention of cemA in green algae and land plants highlights its conserved role in chloroplast function .

  • Biochemical Interactions: Recombinant cemA binds heme, suggesting redox-related activities in chloroplast membranes .

Expression Systems

SystemHostTagYield/PuritySource
BacterialE. coliHis-tag>90%, lyophilizedCreative Biomart
YeastP. pastorisNone>85%, liquidCusabio

Research Uses

  • Structural Studies: Used in X-ray crystallography and NMR to resolve membrane protein architectures .

  • Functional Assays: Investigates chloroplast carbon-concentrating mechanisms and ion transport .

  • Evolutionary Biology: Serves as a marker for studying chloroplast genome reduction in algae .

Technical Notes for Handling

  • Reconstitution: Solubilize in Tris/PBS buffer with 5–50% glycerol to prevent aggregation .

  • Stability: Avoid repeated freeze-thaw cycles; working aliquots stored at 4°C retain activity for ≤1 week .

Comparative Analysis with Homologs

cemA homologs exist across streptophytes and chlorophytes, but Nephroselmis cemA retains unique features:

  • Sequence Divergence: Shares <60% identity with land plant homologs (e.g., Nicotiana sylvestris) .

  • Functional Conservation: Retains proton extrusion capabilities observed in tobacco homologs .

Unresolved Questions and Future Directions

  • Mechanistic Role: Does cemA regulate chloroplast pH or metabolite transport?

  • Evolutionary Drivers: Why is cemA retained in prasinophytes but lost in later-diverging green algae?

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preferred format in the order notes section, and we will prepare accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
To ensure optimal reconstitution, we recommend briefly centrifuging the vial prior to opening. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag preference, please inform us, and we will prioritize its implementation during development.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Nephroselmis olivacea (Green alga)
Target Names
cemA
Target Protein Sequence
MLAQSIRDCILWIRKTPDRALRAAKEAADLYQNIQQESRIYQNLRGANDATVILYLDKEL SQYERTVKLRLQEFRVSSALLRGFEASQTESAETKKMVEEIEMAISRSQFLRSILSASSV KTHKPLAFEKTGIIPRSIPRTFDRLRRELLASSEDLVVQEFRISRYQTLTSLKFLASLIW IPWIVSWFLRVWWLEPTITMFWNQDQTQLFLHRSQEERALSDMRAFQEKVYFEVLVGEAP DPTPEVLQRRIQAKARDLAEASNQNSIESLANLGSDILACLILLAMLSLEKTKIAVLKSF LDELIYSLNDATKAFFLILVTDVFVGFHSTHGWEVILELLFAHFGFPESKKFIFMFVATF PVLLDTVFKYWIFRYLNHISPSTVAVYHNMNE
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is cemA and what is its role in Nephroselmis olivacea chloroplasts?

The chloroplast envelope membrane protein A (cemA) in Nephroselmis olivacea is an integral membrane protein encoded by the chloroplast genome. It is embedded within the chloroplast envelope, which is a two-membrane system surrounding plastids that serves as the site for many specific transport activities . CemA is believed to play critical roles in carbon dioxide (CO₂) uptake and conversion, functioning as part of the carbon-concentrating mechanism (CCM) that enhances photosynthetic efficiency in aquatic environments where CO₂ availability may be limited. The protein contains multiple α-helical transmembrane regions, characteristic of envelope transporters identified through subcellular proteomic approaches . In N. olivacea, cemA is part of the 200,799 bp chloroplast genome (GenBank: AF137379) sequenced by Turmel et al. in 1999 .

How does the genomic context of cemA differ between Nephroselmis species?

The cemA gene shows notable genomic context differences across Nephroselmis species, reflecting evolutionary divergence within this basal lineage of Chlorophyta. While N. olivacea possesses a larger chloroplast genome of 200,799 bp, N. pyriformis has a more compact genome of 111,026 bp . This compaction in N. pyriformis results in a more streamlined organization where the inverted repeat contains no complete protein-coding genes, unlike in N. olivacea . Comparative genomic analysis positions these species in a strongly supported clade where N. pyriformis is sister to N. astigmatica . These genomic differences likely affect the regulatory elements controlling cemA expression and potentially its functional properties, though specific cemA sequences require detailed comparison across the identified species.

What experimental techniques are essential for basic characterization of cemA?

Basic characterization of cemA requires a multi-faceted approach combining molecular, biochemical, and imaging techniques:

  • Gene Identification and Sequence Analysis:

    • PCR amplification using specific primers designed from conserved regions

    • Sequencing and comparative analysis with other chloroplast genomes

  • Protein Expression Analysis:

    • SDS-PAGE on 12-18% acrylamide gels containing 8 M urea for separation

    • Immunoblotting using specific antisera against conserved regions

    • Edman sequencing for N-terminal identification

  • Localization Studies:

    • Subcellular fractionation to isolate highly purified chloroplast envelope membranes

    • Immunogold electron microscopy for precise localization

    • Fluorescent protein tagging for in vivo visualization

  • Functional Assays:

    • Carbon uptake measurements

    • Photosynthetic efficiency assays under varying CO₂ conditions

These techniques provide fundamental information about cemA's structure, expression patterns, and potential functions before advancing to more sophisticated analyses.

What strategies are most effective for recombinant expression of cemA?

Recombinant expression of chloroplast envelope membrane proteins like cemA presents significant challenges due to their hydrophobic nature and complex folding requirements. The following methodological approaches have proven most effective:

  • Expression System Selection:

    Expression SystemAdvantagesLimitationsOptimal for cemA
    E. coliSimple, high yieldMay form inclusion bodiesC-terminal fragments
    Yeast (P. pastoris)Eukaryotic processingLonger cultivation timeFull-length protein
    Algal chloroplastsNative environmentComplex transformationFunctional studies
    Cell-free systemsAvoids toxicityLower yieldsTopology studies
  • Optimization Strategies:

    • Fusion with solubility-enhancing tags (MBP, SUMO)

    • Codon optimization for the selected expression system

    • Use of specialized E. coli strains (C41/C43) designed for membrane proteins

    • Temperature reduction during induction (16-20°C)

    • Addition of specific lipids to mimic the native membrane environment

  • Purification Approach:

    • Two-phase extraction with organic solvents for hydrophobic proteins

    • Detergent screening (DDM, LDAO, MNG) for optimal solubilization

    • Affinity chromatography combined with size-exclusion methods

    • On-column refolding protocols when necessary

  • Verification Methods:

    • Circular dichroism to confirm secondary structure

    • Limited proteolysis to assess proper folding

    • Functional reconstitution in liposomes or nanodiscs

The choice of expression system should be guided by the specific experimental objectives, with prokaryotic systems favoring structural studies and eukaryotic systems preferred for functional characterization.

How can researchers analyze cemA protein-protein interactions within the chloroplast envelope?

Understanding cemA's interaction network is crucial for elucidating its function in carbon concentration and envelope transport. Several complementary approaches can reveal these interactions:

  • In vivo Crosslinking Approaches:

    • Chemical crosslinking with membrane-permeable reagents

    • Photo-activated crosslinking using modified amino acids

    • Proximity-dependent biotin identification (BioID)

    • Split fluorescent protein complementation assays

  • Co-immunoprecipitation Strategies:

    • Development of specific antibodies against cemA

    • Mild solubilization conditions to maintain native interactions

    • Mass spectrometry identification of co-precipitating proteins

  • Membrane Yeast Two-Hybrid (MYTH) System:

    • Modified yeast two-hybrid specifically designed for membrane proteins

    • Allows screening of interaction partners in a membrane environment

    • Can detect both stable and transient interactions

  • Biophysical Characterization:

    • Surface plasmon resonance (SPR) with reconstituted protein

    • Microscale thermophoresis for quantitative binding parameters

    • Förster resonance energy transfer (FRET) for in vivo interactions

  • Computational Prediction and Validation:

    • Sequence-based interaction prediction algorithms

    • Structural modeling of potential interaction interfaces

    • Network analysis using the virtual plastid envelope integral protein database

The integration of these approaches can provide a comprehensive map of cemA's interactome, revealing its role within the complex transport machinery of the chloroplast envelope.

What methodologies are appropriate for analyzing cemA gene expression regulation in different environmental conditions?

The regulation of cemA expression under varying environmental conditions provides insights into its physiological roles. The following methodologies enable comprehensive analysis of this regulation:

  • Transcriptional Analysis:

    • Quantitative RT-PCR under varying CO₂, light, and nutrient conditions

    • RNA-seq to capture global transcriptional changes

    • 5′ RACE to identify transcription start sites and promoter elements

    • Run-on transcription assays to measure transcription rates

  • Promoter Analysis:

    • Construction of reporter gene fusions (GFP, luciferase)

    • Deletion and mutation analysis of promoter elements

    • Electrophoretic mobility shift assays to identify DNA-binding proteins

    • In vivo footprinting to detect protein-DNA interactions

  • Post-transcriptional Regulation:

    • RNA stability assays using transcription inhibitors

    • Identification of RNA-binding proteins through RNA immunoprecipitation

    • Analysis of RNA secondary structures affecting translation efficiency

  • Protein Analysis Under Different Conditions:

    ConditionMethodExpected OutcomePhysiological Relevance
    Low CO₂ImmunoblottingIncreased cemA levelsCarbon concentration role
    High lightProteomicsModified cemA processingPhotoprotection function
    Nutrient limitationEnzyme activityAltered transport ratesResource allocation
    Temperature stressMembrane fractionationChanged membrane associationStress adaptation
  • Systems Biology Approach:

    • Integration of transcriptomic, proteomic, and metabolomic data

    • Network analysis to identify co-regulated genes

    • Mathematical modeling of cemA regulation within carbon fixation pathways

These methodologies provide a comprehensive understanding of how cemA expression responds to environmental cues, offering insights into its adaptive significance.

How can CRISPR-Cas9 genome editing be applied to study cemA function in Nephroselmis olivacea?

CRISPR-Cas9 technology offers powerful approaches for functional genomics studies of cemA in Nephroselmis olivacea, though applying this technology to chloroplast genes requires specialized strategies:

  • Chloroplast Genome Targeting Strategies:

    • Development of chloroplast-targeted Cas9 expression systems

    • Design of guide RNAs specific to cemA regions with minimal off-targets

    • Use of biolistic transformation methods similar to those established for Chlamydomonas

    • Selection on spectinomycin-containing media (100-500 μg/ml) to achieve homoplasmy

  • Editing Approaches:

    • Gene knockout through NHEJ-mediated indel formation

    • Precise base editing using cytidine or adenine deaminase fusions

    • Site-directed mutagenesis of specific functional domains

    • Epitope tagging for protein localization and purification

  • Verification Methods:

    • PCR screening with specific primers and restriction analysis

    • Chelex 100 DNA extraction for rapid genotyping

    • Sequencing to confirm desired modifications

    • Immunoblotting to verify protein expression changes

  • Phenotypic Analysis of Edited Strains:

    • Growth curves under varying CO₂ concentrations

    • Photosynthetic performance measurements

    • Carbon uptake and fixation rates

    • Chloroplast envelope integrity and transport assays

  • Complementation Studies:

    • Reintroduction of wild-type or mutated cemA variants

    • Expression of cemA homologs from other species

    • Conditional expression systems to study essential functions

When applying CRISPR-Cas9 to chloroplast genes, researchers must carefully optimize transformation protocols and selection strategies to ensure complete replacement of all copies of the polyploid chloroplast genome.

What are the critical steps in purifying and characterizing recombinant cemA protein?

Purification and characterization of recombinant cemA present significant technical challenges due to its hydrophobic nature. The following methodology provides optimal results:

  • Extraction and Solubilization:

    • Isolation of membrane fractions through ultracentrifugation

    • Screening of detergents for optimal solubilization efficiency

    • Use of organic solvents for extraction of highly hydrophobic regions

    • Gentle solubilization conditions to maintain native structure

  • Protein Quality Assessment:

    • SDS-PAGE analysis with Coomassie Blue R-250 staining

    • Western blotting with specific antibodies

    • Mass spectrometry for accurate molecular weight determination

    • N-terminal sequencing by Edman degradation

    • Circular dichroism to verify secondary structure content

    • Dynamic light scattering to assess homogeneity

  • Functional Characterization:

    • Reconstitution into liposomes for transport assays

    • Measurement of CO₂ and HCO₃⁻ transport

    • ATPase activity assays if relevant

    • Binding studies with potential interacting partners

    • Structural studies (X-ray crystallography, cryo-EM, NMR)

Each step requires careful optimization, with particular attention to detergent selection and buffer composition to maintain protein stability and activity throughout the purification process.

How can researchers troubleshoot common issues in cemA expression and purification?

When working with recombinant cemA, researchers frequently encounter challenges that can be addressed through systematic troubleshooting approaches:

  • Low Expression Levels:

    IssuePotential CausesSolutions
    Toxicity to hostMembrane disruptionUse tightly regulated promoters
    Lower induction temperature
    Use specialized host strains (C41/C43)
    Protein degradationProtease activityAdd protease inhibitors
    Use protease-deficient strains
    Poor translationCodon biasOptimize codons for expression host
    Use dual promoter systems
  • Inclusion Body Formation:

    • Reduce expression temperature to 16-20°C

    • Add solubility enhancers (sorbitol, glycerol, arginine)

    • Co-express molecular chaperones (GroEL/ES, DnaK/J)

    • Use fusion partners (MBP, SUMO, TrxA)

    • Develop refolding protocols if necessary

  • Inefficient Solubilization:

    • Screen detergent panel (DDM, DM, LDAO, FC-12, SMA polymer)

    • Optimize detergent:protein ratio

    • Test different solubilization temperatures and times

    • Consider native extraction from chloroplast membranes

    • Use lipid nanodiscs for stabilization

  • Purification Challenges:

    • Implement on-column detergent exchange

    • Use GFP fusion to monitor protein stability

    • Add lipids during purification to stabilize structure

    • Optimize buffer components (pH, salt, glycerol)

    • Consider purification in the presence of substrates

  • Loss of Function:

    • Verify correct folding with limited proteolysis

    • Test multiple detergents for activity preservation

    • Reconstitute in liposomes with native lipid composition

    • Identify stabilizing ligands or binding partners

    • Develop activity assays compatible with detergent presence

By systematically addressing these common issues, researchers can significantly improve the yield and quality of recombinant cemA for subsequent structural and functional studies.

What comparative genomic approaches can reveal cemA evolution across green algal lineages?

Comparative genomics provides powerful insights into the evolution of cemA across diverse green algal lineages, including Nephroselmis species:

  • Sequence-Based Analysis:

    • Multiple sequence alignment of cemA homologs

    • Phylogenetic reconstruction using maximum likelihood methods

    • Calculation of selection pressure (dN/dS ratios)

    • Identification of conserved domains and variable regions

    • Analysis of codon usage patterns

  • Genomic Context Analysis:

    • Examination of gene order and synteny around cemA

    • Comparison of inverted repeat content across species

    • Analysis of regulatory elements and promoter regions

    • Identification of potential mobile genetic elements

    • Mapping of gene transfers between compartments

  • Structural Prediction Approaches:

    • Secondary structure prediction across diverse homologs

    • Transmembrane topology modeling and comparison

    • Homology modeling using related structures

    • Prediction of functional domains and binding sites

    • Analysis of protein-protein interaction interfaces

  • Correlation with Habitat and Physiology:

    SpeciesHabitatGenome SizecemA FeaturesPhysiological Correlation
    N. olivaceaFreshwater200,799 bp [Specific features]CO₂ limitations in freshwater
    N. pyriformisMarine111,026 bp [Specific features]Adaptation to marine carbon dynamics
    N. astigmaticaMarine/Brackish[Size][Specific features]Adaptation to variable salinity
  • Integrative Evolutionary Analysis:

    • Correlation of cemA evolution with chloroplast genome size

    • Mapping of character state changes on phylogenetic trees

    • Analysis of co-evolution with interacting proteins

    • Identification of convergent evolution in different lineages

    • Reconstruction of ancestral sequences at key evolutionary nodes

These approaches collectively provide a comprehensive view of how cemA has evolved across green algal lineages, offering insights into its functional adaptation to different ecological niches.

How can cemA research contribute to understanding carbon-concentrating mechanisms in algae?

Research on cemA provides valuable insights into carbon-concentrating mechanisms (CCMs) that enhance photosynthetic efficiency in aquatic environments:

  • Functional Role Analysis:

    • Characterization of cemA's role in inorganic carbon transport

    • Determination of substrate specificity (CO₂ vs. HCO₃⁻)

    • Elucidation of transport kinetics and regulation

    • Integration of cemA function with other CCM components

  • Comparative Studies Across Species:

    • Analysis of cemA sequence and function in species with different CCM efficiencies

    • Correlation of cemA variability with habitat-specific carbon limitations

    • Examination of co-evolution with carbonic anhydrases and other CCM proteins

    • Investigation of cemA in species from diverse aquatic environments

  • Environmental Response Mechanisms:

    • Analysis of cemA expression and activity under varying CO₂ conditions

    • Investigation of post-translational modifications in response to carbon stress

    • Characterization of protein-protein interactions under different CO₂ regimes

    • Integration of cemA regulation with global carbon sensing pathways

  • Structural Basis of Function:

    • Determination of cemA's membrane topology and critical residues

    • Structure-function analysis through targeted mutagenesis

    • Identification of domains involved in substrate recognition and transport

    • Computational modeling of transport mechanisms

  • Biotechnological Applications:

    • Engineering of enhanced cemA variants for improved carbon uptake

    • Development of algal strains with optimized CCMs for biofuel production

    • Creation of biosensors for environmental carbon monitoring

    • Design of synthetic carbon-concentrating systems for crop improvement

Understanding cemA's role in CCMs provides fundamental knowledge that can be applied to enhance photosynthetic efficiency in both natural and engineered systems.

What experimental approaches can determine the membrane topology of cemA?

Determining the membrane topology of cemA is crucial for understanding its function. Multiple complementary experimental approaches provide reliable topology mapping:

  • Computational Prediction as Foundation:

    • Hydropathy analysis to identify potential transmembrane domains

    • Topology prediction algorithms (TMHMM, TOPCONS, Phobius)

    • Comparison with experimentally verified homologs

    • Signal peptide and targeting sequence prediction

  • Biochemical Mapping Techniques:

    • Protease protection assays using purified chloroplast envelopes

    • Site-directed chemical labeling of cysteine residues

    • Glycosylation mapping using engineered glycosylation sites

    • Antibody accessibility studies with domain-specific antibodies

  • Fluorescence-Based Approaches:

    • C-terminal and internal GFP fusions to determine orientation

    • Split-GFP complementation across membrane compartments

    • FRET-based distance measurements between domains

    • pH-sensitive fluorescent protein tags for lumen exposure

  • Mass Spectrometry Strategies:

    • Limited proteolysis combined with MS identification of fragments

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Chemical cross-linking mass spectrometry (XL-MS)

    • Surface biotinylation followed by MS analysis

  • Structural Biology Techniques:

    • Cryo-electron microscopy of 2D crystals or reconstituted protein

    • Solid-state NMR of reconstituted cemA

    • EPR spectroscopy with site-directed spin labeling

    • X-ray crystallography of stable domains or full-length protein

Integration of these approaches provides a comprehensive topology model that serves as the foundation for understanding cemA's structure-function relationships and guiding further experimental design.

What are the most promising future research directions for cemA studies?

Based on current knowledge and technological developments, several promising research directions emerge for advancing our understanding of cemA:

  • High-Resolution Structural Studies:

    • Cryo-EM analysis of cemA alone and in complex with interacting partners

    • Application of advanced membrane protein crystallization techniques

    • Development of nanobody-assisted structural biology approaches

    • Implementation of integrative structural biology combining multiple data types

  • Systems-Level Integration:

    • Multi-omics analysis of cemA within the chloroplast envelope interactome

    • Network modeling of carbon-concentrating mechanisms

    • Characterization of cemA's role in chloroplast-nucleus communication

    • Investigation of co-regulation with other photosynthetic components

  • Evolutionary and Ecological Perspectives:

    • Expanded phylogenetic analysis across diverse algal lineages

    • Correlation of cemA variants with habitat-specific adaptations

    • Investigation of cemA in extremophile algae

    • Ancestral sequence reconstruction and functional characterization

  • Synthetic Biology Applications:

    • Engineering optimized cemA variants for enhanced carbon uptake

    • Development of cemA-based biosensors for environmental monitoring

    • Creation of minimal synthetic carbon-concentrating systems

    • Heterologous expression of algal cemA in crop plants

  • Methodological Advances:

    • Development of improved chloroplast genome editing techniques

    • Advanced imaging approaches for single-molecule tracking in vivo

    • Microfluidic systems for high-throughput functional screening

    • Computational design of cemA variants with novel properties

These research directions leverage cutting-edge technologies to address fundamental questions about cemA function while exploring applications that could contribute to addressing global challenges in agriculture and climate change mitigation.

How can researchers integrate cemA studies with broader photosynthesis research?

Integration of cemA research with broader photosynthesis studies provides a more comprehensive understanding of this critical biological process:

By positioning cemA research within the broader context of photosynthesis, researchers can better understand its evolutionary significance, functional importance, and potential applications in addressing global challenges related to food security and climate change.

What databases and bioinformatic tools are most valuable for cemA research?

Researchers studying cemA can leverage numerous specialized databases and bioinformatic tools:

  • Sequence and Genome Databases:

    • GenBank (AF137379 for N. olivacea chloroplast genome)

    • ChloroGeneDB (specialized database for chloroplast genes)

    • PhycoCosm (algal genome portal)

    • PlastidDB (plastid genome database)

    • UniProt (protein sequences and functional information)

  • Structural Prediction Tools:

    • TMHMM and TOPCONS (transmembrane domain prediction)

    • I-TASSER and AlphaFold (protein structure prediction)

    • CCTOP (consensus constrained topology prediction)

    • PSIPRED (secondary structure prediction)

    • SWISS-MODEL (homology modeling)

  • Functional Analysis Resources:

    • InterPro (protein domain and function analysis)

    • KEGG (metabolic pathway mapping)

    • STRING (protein-protein interaction networks)

    • Plant Reactome (pathway database)

    • MetaCyc (metabolic pathway database)

  • Evolutionary Analysis Tools:

    • MEGA X (molecular evolutionary genetics analysis)

    • IQ-TREE (maximum likelihood phylogeny inference)

    • PAML (phylogenetic analysis by maximum likelihood)

    • MAFFT (multiple sequence alignment)

    • FigTree (phylogenetic tree visualization)

  • Specialized Algal Resources:

    • AlgaeBase (taxonomic and distribution information)

    • Virtual Plastid Envelope Integral Protein Database

    • Phytozome (comparative genomics platform)

    • BLAST-based programs for searching plant databases

    • ChlamyNet (Chlamydomonas interactome database)

Effective utilization of these resources enables researchers to perform comprehensive analyses of cemA, from sequence comparison to structural modeling and functional prediction, supporting both hypothesis generation and experimental design.

What experimental protocols are essential for researchers new to chloroplast membrane protein studies?

Researchers entering the field of chloroplast membrane protein studies should master these essential protocols:

  • Membrane Protein Extraction and Analysis:

    • SDS-PAGE with 12-18% acrylamide gels containing 8 M urea

    • Immunoblotting with specific antibodies on nitrocellulose membranes

    • Blue native PAGE for intact membrane protein complexes

    • Two-dimensional electrophoresis (BN-PAGE followed by SDS-PAGE)

    • Tandem mass spectrometry analysis for protein identification

  • Recombinant Expression Strategies:

    • Cloning strategies for hydrophobic proteins

    • Expression optimization in bacterial systems

    • Chloroplast transformation techniques using biolistic methods

    • Selection and verification of transformants using antibiotics

    • Protein purification using detergent solubilization and chromatography

  • Functional Characterization Assays:

    • Liposome reconstitution for transport studies

    • Patch-clamp electrophysiology for channel activity

    • Substrate binding assays

    • ATPase activity measurements

    • Fluorescence-based transport assays

  • Imaging and Localization Techniques:

    • Confocal microscopy of fluorescent protein fusions

    • Transmission electron microscopy with immunogold labeling

    • Super-resolution microscopy for detailed localization

    • FRET-based interaction studies

    • Live-cell imaging for dynamic processes

Mastering these protocols provides a solid foundation for researchers entering the field, enabling them to generate high-quality data on chloroplast membrane proteins like cemA.

What are the current technological limitations in cemA research and how might they be overcome?

Current cemA research faces several technological challenges that emerging methods may help overcome:

  • Structural Characterization Challenges:

    ChallengeCurrent LimitationEmerging Solutions
    Membrane protein crystallizationLow success rateLipidic cubic phase methods
    Crystallization chaperones (nanobodies)
    X-ray free-electron laser diffraction
    Structure determinationResolution limitationsAdvances in cryo-EM for small membrane proteins
    Integrative structural biology approaches
    Machine learning structure prediction (AlphaFold)
    Dynamic structural changesStatic structures onlyTime-resolved spectroscopy
    Single-molecule FRET
    Hydrogen-deuterium exchange mass spectrometry
  • Functional Analysis Limitations:

    • Development of high-throughput transport assays

    • Creation of cemA-specific inhibitors as research tools

    • Implementation of genetic sensors for transport activity

    • Application of optogenetic approaches for temporal control

    • Development of cell-free systems for rapid functional screening

  • Genetic Manipulation Barriers:

    • Improved chloroplast transformation efficiency

    • Development of CRISPR-Cas systems targeted to chloroplasts

    • Creation of inducible gene expression systems for essential genes

    • Implementation of base editing for precise mutations

    • Establishment of high-throughput screening of chloroplast mutants

  • In Vivo Analysis Challenges:

    • Advanced imaging techniques for single-molecule tracking

    • Sensors for localized pH and ion concentration measurements

    • Improved spatial resolution of protein-protein interactions

    • Non-invasive measurement of transport activities

    • Development of algal tissue culture systems for simplified analysis

  • Computational Limitations:

    • Enhanced algorithms for membrane protein structure prediction

    • Improved molecular dynamics simulations of membrane transport

    • Development of machine learning approaches for functional prediction

    • Integration of multi-omics data for systems-level understanding

    • Advanced phylogenetic methods for fine-scale evolutionary analysis

Addressing these technological limitations through interdisciplinary approaches will significantly advance our understanding of cemA structure, function, and evolution.

How might synthetic biology approaches be applied to engineer cemA for enhanced photosynthetic efficiency?

Synthetic biology offers promising approaches to engineer cemA for improved photosynthetic performance:

  • Rational Design Strategies:

    • Site-directed mutagenesis based on structure-function analyses

    • Domain swapping with homologs from diverse species

    • Protein engineering for altered substrate specificity or transport rates

    • Modification of regulatory elements for optimized expression

    • Engineering of protein-protein interactions for enhanced pathway integration

  • Directed Evolution Approaches:

    • Development of selection systems based on photosynthetic growth

    • Creation of cemA variant libraries through error-prone PCR

    • Implementation of high-throughput screening for improved variants

    • Continuous evolution systems in algal hosts

    • Compartmentalized directed evolution for membrane proteins

  • Systems Engineering Perspectives:

    • Integration of optimized cemA into synthetic carbon-concentrating modules

    • Co-engineering of interacting components for pathway optimization

    • Balancing expression levels within reconfigured carbon uptake systems

    • Implementation of synthetic regulatory circuits for dynamic control

    • Development of orthogonal systems for parallel carbon concentration

  • Novel Functionalities:

    • Engineering cemA to function efficiently at higher temperatures

    • Creation of variants with broader pH tolerance

    • Development of versions with altered ion coupling for energetics

    • Design of chimeric proteins with additional functionalities

    • Engineering of regulatory domains for responsiveness to new signals

  • Implementation Strategies:

    • Chloroplast transformation for direct replacement of native cemA

    • Nuclear expression with optimized chloroplast targeting

    • Development of synthetic chloroplast genomes with redesigned carbon uptake

    • Engineering minimal synthetic chloroplasts with defined components

    • Creation of synthetic carbon-fixing organelles in heterologous hosts

These synthetic biology approaches have the potential to enhance photosynthetic efficiency in both natural and engineered systems, contributing to improved carbon fixation for biofuel production and agricultural applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.