Recombinant Nephroselmis olivacea Cytochrome b6-f complex subunit 4 (petD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nephroselmis olivacea Cytochrome b6-f Complex Subunit 4 (petD)

Recombinant Nephroselmis olivacea Cytochrome b6-f complex subunit 4 (petD) is a recombinant protein derived from the green alga Nephroselmis olivacea. This protein is part of the cytochrome b6-f complex, which plays a crucial role in photosynthesis by facilitating electron transport between photosystems II and I. The cytochrome b6-f complex is essential for both linear and cyclic electron transport in chloroplasts, contributing to the regulation of photosynthetic processes.

Structure and Function

The cytochrome b6-f complex consists of several subunits, including cytochrome b6 (petB), cytochrome f (petA), the Rieske protein (petC), and subunit IV (petD), along with smaller polypeptides like PetG, PetL, PetM, and PetN . Subunit IV (petD) is crucial for the assembly and stability of the complex. In Nephroselmis olivacea, this subunit is expressed as a recombinant protein in Escherichia coli (E. coli) with an N-terminal His tag, facilitating purification and identification .

Table 1: Key Features of Recombinant Nephroselmis olivacea Cytochrome b6-f Complex Subunit 4 (petD)

FeatureDescription
SourceNephroselmis olivacea (Green alga)
Expression HostEscherichia coli (E. coli)
TagN-terminal His tag
Protein LengthFull length (1-160 amino acids)
FormLyophilized powder

Research Findings

Research on the cytochrome b6-f complex has highlighted its role in photosynthesis and its interaction with other components of the photosynthetic apparatus. For instance, studies in Chlamydomonas reinhardtii have shown that the cytochrome b6 subunit interacts with subunit IV (petD) through salt bridges, which are essential for complex assembly . Mutagenesis studies have also been used to explore the function of the petD gene in chloroplasts, demonstrating the importance of this subunit in photosynthetic electron transport .

Table 2: Role of Cytochrome b6-f Complex in Photosynthesis

ProcessRole of Cytochrome b6-f Complex
Linear Electron TransportFacilitates electron transfer from PSII to PSI
Cyclic Electron TransportContributes to cyclic electron flow around PSI
State TransitionsRegulates light energy distribution between PSII and PSI

Applications and Future Directions

The recombinant expression of subunit IV (petD) from Nephroselmis olivacea offers opportunities for studying photosynthetic mechanisms and developing tools for biotechnology applications. This includes potential uses in bioenergy production and improving crop photosynthetic efficiency. Further research could focus on optimizing expression conditions and exploring the structural dynamics of the cytochrome b6-f complex in various photosynthetic organisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify this during your order; we will prioritize fulfilling your request.
Synonyms
petD; Cytochrome b6-f complex subunit 4; 17 kDa polypeptide
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-160
Protein Length
full length protein
Species
Nephroselmis olivacea (Green alga)
Target Names
petD
Target Protein Sequence
MSVTKKPDLTDPVLRAKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTLSCITGLAVLDPA AIGEPANPFATPLEILPEWYFFPVFQLLRTVPNKLLGVLLMAAVPAGLLTVPFIESINKF QNPFRRPVATTVFLIGTVVAIWLGIGATLPIDISLTLGLF
Uniprot No.

Target Background

Function

Component of the cytochrome b6-f complex. This complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome b family, PetD subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Cytochrome b6-f complex and what role does subunit 4 (petD) play in photosynthetic organisms?

The cytochrome b6-f complex is a crucial membrane protein complex that functions in the electron transport chain of photosynthesis. This approximately 220 kDa dimeric complex comprises eight subunits in most organisms, with four major subunits: cytochrome f (PetA), cytochrome b6 (PetB), Rieske iron-sulfur protein (PetC), and subunit IV (PetD) .

Subunit IV (PetD) plays several critical roles:

  • Forms part of the transmembrane domain of the complex

  • Contains helices that contribute to quinone binding sites

  • Participates in proton translocation across the thylakoid membrane

  • Ensures proper assembly and stability of the entire complex

Researchers studying PetD should note that the N-terminal region is particularly important, as recent studies have shown that truncation of this region significantly diminishes electron transfer rates and enhances P700 donor side limitation . This region appears essential for maintaining proper function of the complex's Qi-site, which affects operations at the Qo-site through long-range interactions within the protein complex.

Why is Nephroselmis olivacea significant for studies of chloroplast evolution and the cytochrome b6-f complex?

Nephroselmis olivacea holds unique evolutionary significance as a member of the Prasinophyceae class, thought to include descendants of the earliest-diverging green algae . This positioning makes it valuable for evolutionary studies of photosynthetic machinery.

Key reasons for its research significance include:

  • Its chloroplast genome (200,799 bp) contains 127 genes, representing the largest gene repertoire among green algal and land plant chloroplast DNAs sequenced to date

  • It contains genes not found in other green algal and land plant cpDNAs, including some involved in peptidoglycan synthesis (ftsI, ftsW)

  • It occupies a key phylogenetic position in chloroplast evolutionary studies, often representing the earliest divergence in chloroplast phylogenetic trees

  • Its genome provides insights into ancestral chloroplast genome architecture

When designing evolutionary studies, researchers should note that different phylogenetic markers (chloroplast-encoded proteins vs. 18S rDNA) may yield different branching patterns for prasinophyte lineages, requiring careful consideration of marker selection .

What experimental approaches are most effective for studying the function of recombinant PetD in vitro?

Studying recombinant PetD function requires multiple complementary approaches:

Protein Expression and Purification

  • Expression in E. coli is common for PetD, with N-terminal His-tags aiding purification

  • Consider using specialized membrane protein expression systems if standard E. coli systems yield poor results

  • Extraction with mild detergents like UDM (1 mM) helps maintain native structure

  • Sucrose gradient ultracentrifugation (10-25%) can separate properly folded complexes

Functional Assays

  • Electron transfer measurements:

    • Spectroscopic assays measuring cytochrome f reduction (monitoring absorbance at specific wavelengths)

    • Plastoquinol oxidation assays using decylplastoquinol as substrate

    • Activity can be quantified by PC reduction rates (approximately 120 turnovers per second in active complexes)

  • Structural analysis:

    • Cryo-EM has provided high-resolution (2.1-2.7Å) structures of cytochrome b6f complexes

    • X-ray crystallography for atomic-level insights

    • Circular dichroism to assess secondary structure integrity

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with other subunits

    • Surface plasmon resonance for binding kinetics

Data validation protocol:
For quality control, researchers should verify:

  • Purity by SDS-PAGE (>90% is ideal)

  • Activity using standard turnover assays

  • Spectroscopic profiles (absorption spectra, EPR) compared to native complex

  • Proper reconstitution in membrane-like environments

How do mutations in the petD gene affect the assembly and stability of the cytochrome b6f complex?

Mutations in petD have significant impacts on complex assembly and stability, with different regions affecting different aspects of function:

Assembly Impacts:

  • Complete petD deletion (ΔpetD) in Chlamydomonas reinhardtii prevents accumulation of cytochrome f, severely reducing its synthesis

  • The stability of subunit IV (PetD) strongly depends on the presence of cytochrome b6, indicating a concerted assembly process

  • Point mutations in specific residues can affect assembly without completely disrupting it

Functional Effects:

  • N-terminal truncations significantly impair electron transfer functionality, causing:

    • ~20-fold slowdown in b-heme oxidation

    • ~10-fold slowdown in cytochrome f reduction

    • Diminished electron transfer rates

Key Domains:

  • Stromal loop residues (Asn122, Tyr124, and Arg125) linking helices F and G are critical for state transitions

  • The N-terminal region is essential for Qi-site function, with impairment affecting the Qo-site through long-range effects

Experimental Approaches:

  • Deletion mutant creation (complete gene deletion)

  • Point mutation analysis (site-directed mutagenesis)

  • Domain swapping with orthologous genes

  • Complementation studies with modified genes

When designing mutation studies, researchers should consider:

  • Using pulse-labeling and pulse-chase experiments to assess synthesis rates and turnover

  • Western blotting to analyze protein accumulation

  • Functional assays to determine the impact on electron transfer

  • Structural analysis to confirm proper complex formation

What methods can be used to assess electron transfer rates in mutant forms of PetD?

Analyzing electron transfer rates in mutant PetD variants requires sophisticated biophysical techniques:

Spectroscopic Methods:

  • Time-resolved absorption spectroscopy to track:

    • Cytochrome f reduction kinetics (monitoring specific wavelengths)

    • b-heme oxidation/reduction (comparing rates under oxic vs. anoxic conditions)

    • P700 re-reduction rates

  • Electrochromic shift measurements:

    • Carotenoid absorbance shifts at 520 nm can indicate transmembrane electrogenic phases

    • These measure electron transfer between hemes bL and bH following quinol oxidation

Biochemical Assays:

  • Quinol oxidation assays:

    • Using decylplastoquinol (dPQH2) as substrate

    • Monitoring plastocyanin reduction spectrophotometrically

    • Calculate turnover rates from initial slopes (wild-type ~120 per second)

Biophysical Techniques:

  • Electron paramagnetic resonance (EPR):

    • Perform at low temperatures (10K)

    • Compare oxidized and partially reduced samples

    • Use specific parameters: microwave frequency ~9.39 GHz, microwave power ~6.35 mW

  • Flash photolysis:

    • Single turnover measurements with short flashes

    • Track electron transfer between components

Data Analysis Considerations:

  • Compare mutants under identical conditions with wild-type controls

  • Perform measurements under both aerobic and anaerobic conditions to distinguish different electron transfer pathways

  • Analyze data using appropriate kinetic models (typically multi-exponential fitting)

When interpreting results, researchers should consider that:

  • N-terminal truncations can cause ~25-fold slowdown in high-potential chain electron transfer

  • Some mutations may affect electrogenicity without completely abolishing electron transfer

What evolutionary insights can be gained from studying petD in Nephroselmis olivacea compared to other photosynthetic organisms?

Studying petD in Nephroselmis olivacea provides valuable evolutionary insights into photosynthetic machinery:

Phylogenetic Positioning:

  • Nephroselmis represents an early divergence in the Chlorophyta lineage

  • Its position differs between chloroplast and nuclear gene trees - it represents the earliest divergence in chloroplast-based trees but appears in a later-diverging group in 18S rDNA trees

Gene Content Evolution:

  • The complete chloroplast genome of Nephroselmis olivacea (200,801 bp) contains more genes (128) than other green algae , suggesting gene loss in derived lineages

  • Comparative analysis with other prasinophytes reveals substantial scrambling of gene order despite conservation of numerous gene clusters

Methodological Approaches:

  • Whole genome comparative analysis:

    • Compare gene content, order, and synteny across species

    • Use factor analysis followed by cluster analysis for phylogenetic reconstruction

  • Structural conservation analysis:

    • Examine conservation of key functional domains across lineages

    • Compare the rubredoxin-like membrane proximal domain of the Rieske protein and other conserved elements

  • Inversion and transposition modeling:

    • Use algorithms like GRAPPA to infer rearrangement events

    • Consider different inversion-to-transposition ratios to model genome evolution

Table: Comparison of Nephroselmis chloroplast genomes with other green algae

SpeciesSize (bp)Intergenic (bp)GC%Gene CountIR CountIR%Intron%
Nephroselmis astigmatica125,04213,74259.5123218.60.3
Nephroselmis olivacea200,80146,13757.9128-45.60.5
Pycnococcus provasolii80,211-60.599114.00

This comparative approach reveals that Nephroselmis olivacea has maintained more ancestral chloroplast genes, providing insights into the gene complement of early photosynthetic eukaryotes.

How can researchers address data inconsistencies in studies involving recombinant PetD proteins?

Addressing data inconsistencies is crucial for reliable research with recombinant PetD:

Common Sources of Inconsistency:

  • Protein preparation variability

  • Experimental condition differences

  • Instrumentation calibration issues

  • Data entry errors

  • Protocol deviations

Methodological Solutions:

1. Standardized Reporting Protocols:

  • Implement COBIDAS-like standardized reporting checklists

  • Document all experimental parameters comprehensively

  • Use standardized units and measurements

2. Pre-registration of Experimental Design:

  • Pre-register study plans before data collection

  • Document inclusion/exclusion criteria

  • Define analytical methods in advance

3. Robust Quality Control:

  • Verify protein purity by multiple methods (SDS-PAGE, mass spectrometry)

  • Perform activity assays before structural or functional studies

  • Include consistent positive and negative controls

4. Statistical Validation:

  • Use tools like statcheck to verify statistical calculations

  • Employ Bland-Altman plots to assess differences between measurements

  • Test for significance using appropriate non-parametric tests for non-normally distributed data (e.g., Wilcoxon signed-rank matched-pairs tests)

5. Data Transparency:

  • Report all raw data and processing steps

  • Document all parameter inconsistencies (even within 5-10% of protocol targets)

  • Note that parameter entry errors can cause substantial variations (-98% to +45%) in measurements

Case Study: Impact of Data Entry Inconsistencies

A study on data entry inconsistencies in PET (Positron Emission Tomography) research found that:

  • 41.8% of patient studies showed inconsistencies between records and entries

  • 98.0% differed from protocol targets

  • 50.7% were non-compliant with allowed variations

While this study focused on clinical PET rather than protein research, it illustrates how small inconsistencies can significantly impact final results. For protein studies, similar concerns apply to parameters like protein concentration, buffer composition, and reaction conditions.

What techniques can be used to investigate the interaction between PetD and other subunits of the cytochrome b6f complex?

Investigating interactions between PetD and other subunits requires multiple complementary approaches:

Structural Analysis Techniques:

  • Cryo-electron microscopy (cryo-EM):

    • Can achieve resolutions of 2.7Å or better for the complete complex

    • Allows visualization of the entire complex and subunit interfaces

    • Can reveal bound cofactors and substrates (e.g., plastoquinones)

  • X-ray crystallography:

    • Provides atomic resolution of interfaces

    • May require stabilization of the complex with detergents like UDM

  • Cross-linking mass spectrometry (XL-MS):

    • Identifies residues in close proximity between subunits

    • Can capture transient interactions

Biochemical Approaches:

  • Co-immunoprecipitation:

    • Pull-down PetD and identify interacting partners

    • Can be performed with antibodies against native protein or epitope tags

  • Blue native PAGE:

    • Assess complex formation and stability

    • Compare wild-type and mutant forms

  • Mutant complementation studies:

    • Generate deletion mutants (like ΔpetD)

    • Complement with modified versions to assess rescue

Biophysical Methods:

  • Förster resonance energy transfer (FRET):

    • Label specific sites on different subunits

    • Measure energy transfer as indication of proximity

  • Surface plasmon resonance (SPR):

    • Measure binding kinetics between purified components

    • Determine affinity constants for interactions

Computational Approaches:

  • Molecular dynamics simulations:

    • Model interactions at atomic level

    • Predict effects of mutations or modifications

  • Evolutionary covariance analysis:

    • Identify co-evolving residues between subunits

    • Predict interaction sites based on evolutionary constraints

Key Insights from Previous Studies:

  • PetD stability strongly depends on cytochrome b6 presence

  • Stromal loop residues (Asn122, Tyr124, Arg125) in PetD are involved in interactions affecting state transitions

  • The N-terminal region of PetD affects electron transfer through the complex, suggesting interaction with functional domains of other subunits

When designing interaction studies, researchers should consider combining multiple approaches to build a comprehensive picture of the interaction network within the complex.

What are the potential applications of recombinant Nephroselmis olivacea PetD in synthetic biology?

Recombinant Nephroselmis olivacea PetD offers several advantages for synthetic biology applications:

Fundamental Research Applications:

  • Model system for studying ancient photosynthetic machinery

    • Being from an early-diverging green algal lineage, it represents ancestral features

    • Can provide insights into the evolution of photosynthesis

  • Template for design of artificial electron transport chains

    • The protein's role in electron transfer makes it valuable for designed systems

    • Understanding structure-function relationships can inform synthetic complex design

Practical Applications:

  • Bioenergy production systems

    • Engineered electron transport chains for hydrogen or electricity production

    • Optimized photosynthetic efficiency in biofuel-producing organisms

  • Biosensors

    • Electron transfer capabilities can be harnessed for detection systems

    • Potential redox-based sensing applications

Methodological Considerations:

  • Expression systems: E. coli systems have successfully produced functional protein

  • Purification strategy: His-tagged versions facilitate purification while maintaining function

  • Functional assessment: Activity should be verified using electron transfer assays

  • Incorporation into artificial membranes: Liposome or nanodisc systems may be required

Challenges and Limitations:

  • Membrane protein nature complicates handling and incorporation

  • May require specific lipid environments for optimal function

  • Potential stability issues outside of native complex

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.