Recombinant Nephroselmis olivacea NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Nephroselmis olivacea NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a protein component of the NAD(P)H dehydrogenase (NDH) complex found in the chloroplasts of the green alga Nephroselmis olivacea . The NDH complex is crucial for various electron transport processes within the chloroplast, particularly those related to photosynthesis and response to stress .

Basic Information

AttributeDescription
NameNAD(P)H-quinone oxidoreductase subunit 3, chloroplastic
Alternative NamesNAD(P)H dehydrogenase subunit 3, NADH-plastoquinone oxidoreductase subunit 3
OrganismNephroselmis olivacea (Green alga)
FunctionPart of the NDH complex, involved in electron transport from NAD(P)H to quinones
EC Number1.6.5.-
UniProt IDQ9TKX9

Function in Chloroplasts

The NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) is a component of the NDH complex, which mediates the transfer of electrons from NAD(P)H to quinones in the photosynthetic electron transport chain . This complex is vital for:

NDH Complex and Related Research

The NDH complex, which includes the ndhC subunit, is involved in cyclic electron flow around photosystem I (PSI) under stress conditions and is essential for efficient photosynthesis . Ten plant chloroplast-specific NDH subunits have been identified, and their positions and interactions within the NDH complex have been elucidated .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a particular tag, please specify it in advance; we will prioritize fulfilling requests for specified tags.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Nephroselmis olivacea (Green alga)
Target Names
ndhC
Target Protein Sequence
MMILEGYGSVLAFFVIASLIPVIALSASKLLRPRGGGPERRTTYESGIEPMGEAWIQFNI RYYMFALVFVVFDVETLFLYPWAVTFQRLGLSAFFEVLIFIIVLLIGLVYAWRKGALEWS
Uniprot No.

Target Background

Function

NDH shuttles electrons from NAD(P)H:plastoquinone, via FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic electron transport chain and possibly a chloroplast respiratory chain. In this species, the immediate electron acceptor is believed to be plastoquinone. The enzyme couples this redox reaction to proton translocation, thus conserving redox energy as a proton gradient.

Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Nephroselmis olivacea ndhC and what is its functional significance in chloroplast biology?

Nephroselmis olivacea ndhC encodes the subunit 3 of the NAD(P)H-quinone oxidoreductase (NDH) complex located in the chloroplast. This protein is part of a larger complex that likely participates in cyclic electron flow around photosystem I in the light and in chlororespiration in the dark . The discovery of ndhC and other ndh genes in N. olivacea was significant as it represented the first documentation of these genes in algal chloroplast DNA, whereas previously they had only been identified in land plant chloroplast genomes .

The NDH complex appears to be dispensable for plant growth under optimal conditions, but may play important roles in stress responses and photoprotection. The functional significance of ndhC in N. olivacea likely relates to alternative electron transport pathways that help the organism adapt to varying light conditions and environmental stresses.

How is the ndhC gene organized in the Nephroselmis olivacea chloroplast genome?

In the Nephroselmis olivacea chloroplast genome, the ndhC gene is part of a distinct gene cluster. Specifically, it belongs to the ndhC-K linkage group, which is one of three ndh gene clusters identified in this organism . This arrangement mirrors similar organizational patterns found in land plants, with the notable exception that the ndhC cluster in N. olivacea lacks the ndhJ gene that is typically present in land plant chloroplast genomes .

The complete chloroplast genome of N. olivacea spans 200,799 base pairs and contains a total of 127 genes, representing the largest gene repertoire among green algal and land plant chloroplast DNAs that had been completely sequenced at the time of documentation . The preservation of gene order in ndh gene clusters between N. olivacea and land plants suggests evolutionary conservation of these genomic regions, despite their absence in many other algal lineages.

What are the evolutionary implications of finding ndh genes in Nephroselmis olivacea?

The presence of ndh genes in Nephroselmis olivacea has profound evolutionary implications. As a member of the Prasinophyceae, which is thought to include descendants of the earliest-diverging green algae, N. olivacea represents a critical reference point for understanding the evolution of the chloroplast genome . The discovery of 10 ndh homologs in this organism, previously only reported in land plant chloroplast DNAs, suggests that these genes were present in the common ancestor of chlorophytes and streptophytes .

The conservation of ndh gene clusters between N. olivacea and land plants, particularly the three linkage groups (ndhC–K, ndhH–A–I–G–E, and psaC-ndhD), provides evidence for the antiquity of these genomic arrangements . Interestingly, the subsequent loss of all chloroplast ndh genes in various algal lineages and in some land plants (e.g., Pinus) raises important questions about their functional significance throughout evolutionary history and the selective pressures that may have led to their retention or loss in different photosynthetic organisms.

What expression systems are most suitable for recombinant production of Nephroselmis olivacea ndhC?

For recombinant production of Nephroselmis olivacea ndhC, researchers must consider several expression systems with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, rapid growth, cost-effective, extensive genetic toolsLacks post-translational modifications, inclusion body formation common, membrane protein challengesInitial structural studies, antibody production, protein interaction assays
Yeast (S. cerevisiae, P. pastoris)Eukaryotic post-translational processing, effective for membrane proteins, scaled productionLower yields than E. coli, longer expression timeFunctional studies requiring eukaryotic modifications
Insect cells (Baculovirus)Complex eukaryotic processing, suitable for membrane proteinsHigh cost, technical complexity, longer production timeStructural studies requiring native-like folding
Chloroplast-targeted expression in C. reinhardtiiNative-like environment, co-expression with interaction partnersLower yields, complex transformation proceduresIn vivo functional studies, complex assembly studies

When expressing ndhC in E. coli, optimizing codon usage for prokaryotic expression is essential, as chloroplast genes often retain features of their prokaryotic ancestry but may have evolved specific codon preferences. For membrane proteins like ndhC, specialized E. coli strains such as C41(DE3) or C43(DE3) designed for membrane protein expression should be considered.

The inclusion of appropriate fusion tags (such as His6, MBP, or SUMO) can facilitate both solubility and purification. For structural and functional studies, careful removal of these tags may be necessary to ensure native-like properties of the recombinant protein.

How can structural studies of recombinant Nephroselmis olivacea ndhC contribute to understanding NDH complex assembly?

Structural studies of recombinant Nephroselmis olivacea ndhC can provide critical insights into NDH complex assembly through several approaches:

  • Cryo-electron microscopy of reconstituted subcomplexes containing ndhC can reveal interaction interfaces and assembly mechanisms. By comparing these structures with known NDH complex structures from cyanobacteria and land plants, researchers can identify conserved and divergent assembly features.

  • Crosslinking mass spectrometry (XL-MS) with purified recombinant ndhC and other NDH subunits can map specific interaction sites, elucidating the spatial arrangement within the complex. This is particularly valuable given that the ndhC-K gene cluster in N. olivacea differs from that in land plants by lacking ndhJ .

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can identify regions of recombinant ndhC that undergo conformational changes upon interaction with other subunits, providing dynamic information about assembly processes.

  • NMR spectroscopy of isotopically labeled recombinant ndhC can characterize its structure in different lipid environments, offering insights into how membrane integration affects complex assembly.

These structural approaches, when combined with bioinformatic analyses comparing ndhC sequences across evolutionary divergent photosynthetic organisms, can reveal conserved structural elements essential for NDH complex assembly and function, potentially explaining why these genes have been selectively retained in some lineages while lost in others.

What are the key methodological challenges in purifying functional recombinant Nephroselmis olivacea ndhC?

Purifying functional recombinant Nephroselmis olivacea ndhC presents several methodological challenges that researchers must address:

  • Membrane protein solubilization: As a subunit of the membrane-embedded NDH complex, ndhC requires careful detergent selection for extraction from expression host membranes. A systematic screen of detergents (maltoside, glucoside, and fos-choline series) is recommended, assessing protein stability and activity in each condition.

  • Maintaining native structure: The protein's functionality depends on preserving its native conformation during purification. Techniques such as fluorescence-detection size exclusion chromatography (FSEC) can be employed to monitor protein monodispersity and stability throughout purification.

  • Co-purification requirements: NdhC may require association with other NDH subunits for stability and function. Co-expression with other subunits from the ndhC-K linkage group might be necessary to obtain functional protein .

  • Activity assay development: Establishing reliable activity assays for isolated ndhC is challenging as it normally functions within the larger NDH complex. Researchers must develop specific assays that can detect electron transfer capability in the recombinant protein.

  • Reconstitution into membrane mimetics: For functional studies, ndhC should be reconstituted into a suitable membrane environment. Options include proteoliposomes, nanodiscs, or amphipols, each requiring optimization for the specific protein.

A successful purification protocol might involve sequential chromatography steps (affinity, ion exchange, and size exclusion) in the presence of stabilizing agents such as glycerol, specific lipids, and mild detergents, followed by careful reconstitution into a membrane mimetic system that preserves functional properties.

How can recombinant Nephroselmis olivacea ndhC be used to study the evolution of photosynthesis?

Recombinant Nephroselmis olivacea ndhC serves as a powerful tool for studying photosynthesis evolution through several research approaches:

  • Complementation studies in ndh-deficient mutants from diverse photosynthetic organisms can reveal functional conservation and divergence. Introducing recombinant N. olivacea ndhC into cyanobacterial or land plant mutants and assessing restoration of NDH activity can provide insights into evolutionary adaptability.

  • Comparative biochemical characterization of recombinant ndhC from N. olivacea versus land plants and cyanobacteria can identify modifications in electron transfer properties. This is particularly significant given that N. olivacea represents an early-diverging green algal lineage, potentially preserving ancestral features of the NDH complex .

  • Protein-protein interaction studies using recombinant ndhC can map interaction network evolution. Pull-down assays with tagged ndhC and chloroplast extracts from evolutionary diverse organisms can identify conserved and lineage-specific interaction partners.

  • Site-directed mutagenesis of conserved residues identified through multi-species alignments can functionally test evolutionary hypotheses about structure-function relationships in the NDH complex.

The special significance of N. olivacea ndhC lies in its position within an organism that retains gene arrangements resembling those in land plants, despite belonging to a separate green plant lineage (Chlorophyta) . The three linkage groups containing ndh genes (ndhC–K, ndhH–A–I–G–E, and psaC-ndhD) show remarkable conservation, suggesting these arrangements were present in the common ancestor of chlorophytes and streptophytes . Studies using recombinant ndhC can therefore illuminate the selective pressures that maintained these genes in some lineages while leading to their loss in others.

What protocols are recommended for optimizing expression of recombinant Nephroselmis olivacea ndhC in E. coli?

Optimizing expression of recombinant Nephroselmis olivacea ndhC in E. coli requires a systematic approach:

  • Gene synthesis and codon optimization:

    • Synthesize the ndhC gene with codons optimized for E. coli expression

    • Include an N-terminal tag (His6 or MBP) to improve solubility and facilitate purification

    • Design constructs with different fusion partners and cleavage sites for flexibility in purification strategies

  • Expression strain selection:

    • Test specialized membrane protein expression strains (C41/C43(DE3), Lemo21(DE3))

    • Evaluate strains with different redox environments (SHuffle, Origami) to facilitate proper disulfide bond formation if present

    • Consider strains with rare tRNA supplementation (Rosetta, CodonPlus)

  • Expression conditions optimization:

ParameterVariables to TestMonitoring Method
Temperature37°C, 30°C, 25°C, 18°C, 16°CSDS-PAGE and Western blot
IPTG concentration0.1 mM, 0.5 mM, 1.0 mMSDS-PAGE and Western blot
MediaLB, TB, 2YT, M9 minimalCell density (OD600) and protein yield
Induction timeMid-log, late-log phaseSDS-PAGE and Western blot
Expression duration3h, 6h, overnight, 24hTime-course sampling and analysis
AdditivesGlycerol (5-10%), sorbitol (0.5-1M), betaine (1-2.5mM)Solubility improvement assessment
  • Membrane extraction protocol:

    • Test different cell disruption methods (sonication, French press, enzymatic lysis)

    • Compare gentle detergents for initial solubilization (DDM, LMNG, digitonin)

    • Optimize detergent:protein ratios through systematic screening

  • Verification methods:

    • Western blotting with anti-His or anti-ndhC antibodies

    • In-gel fluorescence for GFP-fusion constructs

    • Mass spectrometry verification of purified protein

A typical optimized protocol might employ BL21(DE3) or C41(DE3) cells transformed with a pET-based vector containing codon-optimized ndhC with an N-terminal His6-SUMO tag, grown in TB media supplemented with 0.5% glucose, induced with 0.5 mM IPTG at OD600 of 0.6-0.8, and expressed overnight at 18°C before harvesting and membrane preparation.

How can site-directed mutagenesis of recombinant Nephroselmis olivacea ndhC illuminate structure-function relationships?

Site-directed mutagenesis of recombinant Nephroselmis olivacea ndhC can strategically target residues to reveal critical structure-function insights through these methodological approaches:

  • Identification of target residues:

    • Perform multiple sequence alignments of ndhC from diverse photosynthetic organisms including cyanobacteria, algae, and land plants

    • Identify highly conserved residues across all lineages, suggesting essential functional roles

    • Select residues unique to Nephroselmis or algal lineages, potentially indicating adaptation-specific functions

    • Use homology modeling based on known NDH complex structures to identify residues in predicted functional sites

  • Mutant design strategy:

    • Create conservative mutations (e.g., D→E, K→R) to test the importance of chemical properties

    • Generate non-conservative mutations (e.g., D→A, K→A) to eliminate side chain functionality

    • Design domain swaps with corresponding regions from land plant or cyanobacterial homologs

    • Create systematic alanine scanning mutations across predicted transmembrane helices

  • Functional assessment methods:

    • Electron transfer activity assays using artificial electron donors/acceptors

    • Reconstitution experiments with other purified NDH subunits to test complex assembly

    • Thermal stability measurements to assess structural integrity

    • Binding assays with partner proteins and cofactors

  • Structural impact analysis:

    • Circular dichroism spectroscopy to evaluate secondary structure changes

    • Intrinsic fluorescence spectroscopy to detect tertiary structure alterations

    • Limited proteolysis to identify regions with altered conformational stability

    • HDX-MS to map changes in solvent accessibility and protein dynamics

Key residues to target would include those in the predicted quinone-binding site, residues at the interface with other NDH complex subunits (particularly those in the ndhC-K linkage group) , and amino acids in regions predicted to undergo conformational changes during the catalytic cycle. The results from such mutagenesis studies can provide valuable insights into how the unique evolutionary position of Nephroselmis olivacea, as an early-diverging green alga that retained ndh genes, relates to structural adaptations in its NDH complex.

What techniques are most effective for analyzing interactions between recombinant Nephroselmis olivacea ndhC and other NDH complex subunits?

To effectively analyze interactions between recombinant Nephroselmis olivacea ndhC and other NDH complex subunits, researchers should employ a multi-technique approach:

  • Co-purification strategies:

    • Co-expression of ndhC with other subunits, particularly those from the ndhC-K gene cluster , in appropriate expression systems

    • Tandem affinity purification with differentially tagged subunits

    • Size exclusion chromatography to identify stable subcomplexes

    • Gradient ultracentrifugation to isolate intact complexes

  • Biophysical interaction analysis methods:

TechniqueApplicationAdvantagesLimitations
Surface Plasmon Resonance (SPR)Binding kineticsReal-time measurement, minimal sample requirementRequires immobilization, potential surface effects
Isothermal Titration Calorimetry (ITC)Thermodynamic parametersLabel-free, provides complete thermodynamic profileHigher protein amounts needed, limited by solubility
Microscale Thermophoresis (MST)Binding affinity in solutionWorks in native-like detergent environments, small sample volumesRequires fluorescent labeling
Analytical Ultracentrifugation (AUC)Complex formationDetermines stoichiometry and shape, detergent compatibleTime-consuming, specialized equipment
  • Proximity-based interaction mapping:

    • Chemical crosslinking followed by mass spectrometry (XL-MS) to identify interaction interfaces

    • Site-specific photocrosslinking with unnatural amino acids incorporated at predicted interaction sites

    • FRET analysis with fluorescently labeled subunits to detect proximity and conformational changes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map regions protected upon complex formation

  • Functional reconstitution assays:

    • Systematic reconstitution of subcomplexes with defined subunit composition

    • Activity measurements to correlate subunit interactions with functional outcomes

    • Electron microscopy of reconstituted complexes to visualize subunit arrangement

    • Lipid nanodiscs incorporation to study complex assembly in membrane environment

For Nephroselmis olivacea NDH complex studies, special attention should be paid to the three genetic linkage groups identified in the chloroplast genome (ndhC–K, ndhH–A–I–G–E, and psaC-ndhD) , as these may represent functional modules within the complex. Comparative analysis with corresponding subunits from land plants can reveal conserved interaction networks and Nephroselmis-specific adaptations.

How should contradictory results in activity assays of recombinant Nephroselmis olivacea ndhC be interpreted?

When facing contradictory results in activity assays of recombinant Nephroselmis olivacea ndhC, researchers should implement a systematic troubleshooting and interpretation framework:

  • Differentiate between experimental variability and true biological significance:

    • Implement rigorous statistical analysis including power calculations to determine required sample sizes

    • Use multiple biological replicates (different protein preparations) and technical replicates

    • Apply appropriate statistical tests (ANOVA, t-tests) to determine if differences are statistically significant

    • Calculate effect sizes to assess biological relevance beyond statistical significance

  • Evaluate assay-specific factors:

    • Compare results across different activity assay methods (spectrophotometric, polarographic, fluorescence-based)

    • Assess temperature and pH dependence to identify optimal conditions and potential sensitivity factors

    • Test substrate concentration ranges to generate complete kinetic profiles rather than single-point measurements

    • Evaluate assay buffer compositions and ionic strength effects on activity

  • Consider protein preparation variables:

    • Correlate activity with protein purity and integrity (SDS-PAGE, mass spectrometry)

    • Assess effects of different detergents, lipids, and membrane mimetics on measured activity

    • Evaluate how expression system choice affects post-translational modifications and activity

    • Test activity retention over time to identify stability issues affecting measurements

  • Contextualize within biological knowledge:

    • Compare results with known NDH complex activities from related organisms

    • Consider that ndhC functions as part of a larger complex, requiring other subunits for full activity

    • Evaluate whether the linkage group context (ndhC-K in Nephroselmis) suggests functional dependencies

    • Assess whether experimental conditions match physiological conditions of the native chloroplast environment

  • Resolution strategies for contradictory results:

    • Develop a consensus assay protocol based on conditions yielding most consistent results

    • Implement orthogonal activity measurements to validate findings

    • Consider that different results may reflect different functional states of the protein

    • Use mutagenesis studies of conserved residues to correlate structure with variable activity observations

The evolutionary significance of Nephroselmis olivacea ndhC as part of one of the first documented algal NDH complexes makes careful interpretation of activity data particularly important, as it may reveal unique functional adaptations in this early-diverging green algal lineage.

What bioinformatic approaches can be used to predict post-translational modifications of Nephroselmis olivacea ndhC?

To predict and analyze potential post-translational modifications (PTMs) of Nephroselmis olivacea ndhC, researchers should employ a comprehensive bioinformatic workflow:

  • Sequence-based PTM prediction tools:

Modification TypeRecommended ToolsSpecial Considerations
PhosphorylationNetPhos, PhosphoSite, DISPHOSFocus on stromal-exposed regions
AcetylationNetAcet, PAIL, GPS-PAILConsider evolutionary conservation
MethylationPMeS, GPS-MSPAnalyze arginine/lysine contexts
Disulfide bondsDiANNA, DISULFINDAssess redox environment relevance
Transit peptide processingChloroP, TargetPCritical for chloroplast-encoded proteins
N-terminal modificationsTermiNator, NetNGlycConsider prokaryotic-like processing
  • Structural context integration:

    • Generate homology models of Nephroselmis olivacea ndhC using templates from resolved NDH complex structures

    • Map predicted PTM sites onto structural models to assess surface accessibility

    • Evaluate proximity of predicted PTM sites to functional domains or interaction interfaces

    • Use molecular dynamics simulations to assess how PTMs might affect protein dynamics

  • Evolutionary conservation analysis:

    • Perform multiple sequence alignments of ndhC across cyanobacteria, algae, and land plants

    • Identify conserved residues at predicted PTM sites, suggesting functional importance

    • Apply tools like ConSurf to map conservation onto structural models

    • Compare with experimentally verified PTMs in related proteins from model organisms

  • Integration with experimental data:

    • Design targeted proteomic experiments to validate predicted PTMs

    • Develop specific enrichment strategies for predicted modification types

    • Plan site-directed mutagenesis of predicted PTM sites to test functional significance

    • Consider how differential PTM patterns might relate to the unique evolutionary position of Nephroselmis olivacea

  • Functional context analysis:

    • Analyze the ndhC-K gene cluster context for potential co-regulation of PTM-related enzymes

    • Consider environmental conditions that might trigger specific PTMs in Nephroselmis

    • Evaluate how predicted PTMs might influence assembly of the three ndh gene linkage groups (ndhC–K, ndhH–A–I–G–E, and psaC-ndhD)

    • Assess potential role of PTMs in regulating NDH complex activity under varying light or stress conditions

This comprehensive bioinformatic approach should yield testable hypotheses about the PTM landscape of Nephroselmis olivacea ndhC, informing experimental designs for validation and functional characterization.

How can evolutionary rate analysis of ndhC sequences inform our understanding of selection pressures on the NDH complex?

Evolutionary rate analysis of ndhC sequences provides valuable insights into selection pressures acting on the NDH complex across photosynthetic organisms, particularly given the unique presence of ndh genes in Nephroselmis olivacea among algal chloroplast genomes :

  • Selection pressure analysis methods:

    • Calculate nonsynonymous (dN) to synonymous (dS) substitution ratios (dN/dS or ω) to detect selective constraints

    • Implement codon-based maximum likelihood models (PAML, HyPhy) to identify sites under positive, negative, or relaxed selection

    • Apply branch-site models to detect lineage-specific selection patterns, particularly comparing Nephroselmis to land plants and cyanobacteria

    • Conduct sliding window analysis to identify domains with varying selection intensities

  • Functional correlation analysis:

    • Map sites under different selection regimes onto structural models of ndhC

    • Correlate selection patterns with functional domains, active sites, and protein-protein interaction interfaces

    • Analyze selection pressures in the context of the three conserved ndh gene linkage groups (ndhC–K, ndhH–A–I–G–E, and psaC-ndhD)

    • Test for co-evolution between ndhC and other subunits using methods like CAPS or MirrorTree

  • Interpretation of selection signatures:

Selection PatternPotential InterpretationMethodological Approach
Strong purifying selectionEssential functional constraintsSite-specific dN/dS < 1, significant likelihood ratio tests
Episodic positive selectionAdaptation to specific environmentsBranch-site models, mixed effects likelihood approach
Relaxed selectionReduced functional constraints, potential pseudogenizationElevated ω values, significant TreeSAAP scores
Heterogeneous selectionDomain-specific functional constraintsSliding window analysis, Fixed Effects Likelihood method
  • Comparative genomic context:

    • Analyze the retention, loss, or transfer patterns of ndh genes across green algal lineages

    • Evaluate conservation of gene order in the ndhC-K linkage group compared to land plants and cyanobacteria

    • Assess correlation between environmental niches and selection patterns on ndhC

    • Consider the significance of Nephroselmis retaining ndh genes while other algal lineages lost them

  • Experimental validation strategy:

    • Design site-directed mutagenesis experiments targeting sites under different selection regimes

    • Test functional effects of introducing ancestral states at variable positions

    • Evaluate phenotypic effects of chimeric constructs combining domains under different selection pressures

    • Develop complementation assays in ndh-deficient mutants to test functional conservation

The evolutionary analysis of ndhC is particularly informative given that Nephroselmis olivacea represents an early-diverging green algal lineage that has retained ndh genes in gene clusters mirroring those of land plants . This provides a unique opportunity to understand the selective forces that maintained these genes in some lineages while leading to their complete loss in others, potentially relating to environmental adaptations and functional redundancy in photosynthetic electron transport pathways.

What are the most promising future research directions for recombinant Nephroselmis olivacea ndhC studies?

The study of recombinant Nephroselmis olivacea ndhC opens several promising research avenues that could significantly advance our understanding of photosynthetic electron transport and chloroplast evolution:

  • Structural biology frontiers:

    • High-resolution cryo-electron microscopy of reconstituted NDH subcomplexes containing recombinant ndhC

    • Integration of structural data from multiple techniques (X-ray crystallography, NMR, SAXS) for comprehensive structural characterization

    • Time-resolved structural studies to capture conformational changes during the catalytic cycle

    • Comparative structural biology of NDH complexes across evolutionary diverse organisms

  • Synthetic biology applications:

    • Engineering optimized NDH complexes incorporating Nephroselmis ndhC for enhanced cyclic electron flow

    • Creating minimal synthetic NDH subcomplexes to define essential components for electron transport

    • Developing biosensors based on ndhC conformational changes for monitoring photosynthetic efficiency

    • Exploring biotechnological applications leveraging the unique properties of algal NDH components

  • Evolutionary biology investigations:

    • Detailed phylogenomic analyses incorporating newly sequenced early-diverging algal species

    • Functional complementation studies in diverse photosynthetic organisms to test evolutionary conservation

    • Reconstruction of ancestral sequences to test hypotheses about NDH complex evolution

    • Investigation of horizontal gene transfer events potentially explaining the patchy distribution of ndh genes

  • Physiological significance studies:

    • Characterization of ndhC function under various stress conditions (high light, temperature, drought)

    • Investigation of how the NDH complex integrates with other photosynthetic and respiratory components

    • Exploration of potential regulatory mechanisms controlling NDH complex activity

    • Comparison of cyclic electron flow efficiency between organisms with different NDH complex compositions

These research directions are particularly significant given Nephroselmis olivacea's position as an early-diverging green alga that has retained ndh genes in three distinct linkage groups (ndhC–K, ndhH–A–I–G–E, and psaC-ndhD) . Understanding the structure, function, and evolution of these components may reveal fundamental aspects of photosynthetic electron transport that have been conserved across the green lineage and explain why these genes have been selectively retained or lost in different photosynthetic organisms.

How can contradictions in the literature regarding NDH complex function be resolved through studies of Nephroselmis olivacea ndhC?

The study of recombinant Nephroselmis olivacea ndhC offers unique opportunities to resolve several persistent contradictions in the literature regarding NDH complex function:

  • Addressing the contradiction regarding NDH complex dispensability:

    • Studies have shown that NDH complexes appear dispensable under optimal conditions yet are widely conserved

    • Systematic phenotyping of systems with recombinant N. olivacea ndhC under diverse stress conditions can identify specific scenarios where the complex provides fitness advantages

    • Comparative studies between Nephroselmis (which retained ndh genes) and closely related algae that lost these genes can reveal subtle but significant physiological differences

  • Resolving uncertainties about electron donor specificity:

    • Conflicting reports exist regarding whether NAD(P)H is the direct electron donor to the complex

    • Biochemical characterization of recombinant N. olivacea ndhC and reconstituted subcomplexes with various potential electron donors can establish substrate preferences

    • Structure-guided mutagenesis of putative nucleotide-binding sites can test hypothesized electron transfer pathways

  • Clarifying the evolutionary relationship between chloroplast and cyanobacterial NDH complexes:

    • Structural and functional comparisons between recombinant N. olivacea ndhC and corresponding cyanobacterial components

    • Investigation of how the ndhC-K linkage group in Nephroselmis relates functionally to similar arrangements in cyanobacteria and land plants

    • Evolutionary rate analysis to identify convergent and divergent features between these systems

  • Addressing contradictory models of NDH complex assembly:

    • In vitro assembly studies with recombinant N. olivacea ndhC and other subunits

    • Time-resolved structural studies to capture assembly intermediates

    • Complementation studies in various mutant backgrounds to test assembly requirements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.