Recombinant Nephroselmis olivacea NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic (ndhE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, kindly contact your local distributors.
Note: Our proteins are standardly shipped with blue ice packs. Should you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to concentrate the contents. Reconstitute the protein with deionized sterile water to a concentration ranging from 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, serving as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Nephroselmis olivacea (Green alga)
Target Names
ndhE
Target Protein Sequence
MIFQSYLLIAASMFCIGLYGLLTSRNVVRVLMSLELLLNAVNLNLLTFSNFVDSHEMKGQ VLALFVIALAAAEAAIGLAIILSIYRNQRTVDPEQFNLLKW
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic chain and potentially in a chloroplast respiratory chain. In this specific species, the immediate electron acceptor for the enzyme is thought to be plastoquinone. It couples the redox reaction with proton translocation, thereby conserving the redox energy as a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Nephroselmis olivacea and why is it significant for evolutionary research?

Nephroselmis olivacea is a member of the Prasinophyceae class of green algae, which is thought to include descendants of the earliest-diverging green algae. This organism holds particular significance in evolutionary studies because it represents an early offshoot of the Chlorophyta lineage . The complete chloroplast DNA (cpDNA) sequence of Nephroselmis olivacea has been determined to be 200,799 bp, representing the largest gene repertoire among green algal and land plant chloroplast DNAs sequenced to date . As such, this organism provides crucial insights into the ancestral characteristics of green algal chloroplast genomes and serves as an important reference point for understanding chloroplast genome evolution in the plant kingdom.

What is the ndhE gene and what is its function in chloroplasts?

The ndhE gene encodes a subunit (subunit 4L) of the NADH:ubiquinone oxidoreductase complex (also known as complex I or NDH complex) located in the chloroplast. This complex is involved in electron transport processes in chloroplasts, particularly in cyclic electron flow around the photosystem I complex during light conditions and in chlororespiration in dark conditions . The ndhE gene product functions as one of the membrane-embedded subunits of this complex, contributing to proton translocation across the thylakoid membrane. This activity ultimately contributes to ATP synthesis and helps optimize photosynthetic efficiency under varying environmental conditions.

Why is the presence of ndh genes in Nephroselmis olivacea chloroplast significant?

The presence of ndh genes, including ndhE, in Nephroselmis olivacea chloroplast DNA represents a significant finding because these genes had not been previously reported in any algal chloroplast genome prior to the sequencing of Nephroselmis . Ten homologs of mitochondrial genes encoding subunits of NADH:ubiquinone oxidoreductase were found in the Nephroselmis chloroplast genome, similar to what has been observed in land plant chloroplast genomes . This discovery suggests that ndh genes were present in the common ancestor of chlorophytes and streptophytes but were subsequently lost independently in multiple algal lineages. This pattern of retention and loss raises important questions about the functional significance of these genes in different photosynthetic organisms.

What methodologies are most effective for isolating and sequencing the ndhE gene from Nephroselmis olivacea?

Isolating and sequencing the ndhE gene from Nephroselmis olivacea requires a systematic approach to DNA extraction and amplification. Based on methodologies used in previous studies, an effective protocol includes:

  • Initial isolation of total cellular DNA using CsCl-bisbenzimide gradients, although as noted in previous research, nuclear and organelle DNAs of N. olivacea cannot be resolved using this method alone .

  • Construction of a library of total cellular DNA by ligating partially digested and partially filled-in MboI fragments to appropriate vectors (such as LambdaGEM-11) .

  • Identification of clones carrying chloroplast DNA inserts through hybridization with known cpDNA fragments from related species (such as Chlamydomonas).

  • PCR amplification of the ndhE region using primers designed based on conserved regions of the gene.

  • Sequencing of the amplified products using modern high-throughput sequencing methods.

  • Confirmation of the sequence through comparative analysis with known ndhE sequences from other organisms.

This methodological approach ensures high-quality sequence data while minimizing contamination from nuclear DNA.

What are the most effective protocols for expressing recombinant Nephroselmis olivacea ndhE protein?

Expression of recombinant Nephroselmis olivacea ndhE protein presents several challenges due to its membrane-associated nature and potential toxicity to expression hosts. Based on parallel approaches used for similar proteins, an effective protocol includes:

  • Codon optimization of the ndhE gene sequence for the chosen expression system (typically E. coli, yeast, or insect cells).

  • Cloning the optimized sequence into an expression vector with an appropriate affinity tag (such as His6, FLAG, or GST) to facilitate purification.

  • Expression in a system capable of membrane protein production:

    • E. coli strains C41(DE3) or C43(DE3) designed for membrane protein expression

    • Yeast systems such as Pichia pastoris for eukaryotic post-translational modifications

    • Insect cell/baculovirus systems for higher yields of complex proteins

  • Induction under mild conditions (lower temperature and inducer concentration) to prevent formation of inclusion bodies.

  • Extraction using specialized detergents that maintain protein structure and function, such as n-dodecyl-β-D-maltoside (DDM) or digitonin.

  • Purification via affinity chromatography followed by size exclusion chromatography to maintain the native structure.

  • Verification of protein integrity through Western blotting and activity assays.

This approach maximizes the likelihood of obtaining functional recombinant ndhE protein for subsequent analyses.

How can structural studies of ndhE contribute to understanding chloroplast evolution?

Structural studies of the ndhE protein can provide critical insights into chloroplast evolution through several approaches:

The NAD(P)H-quinone oxidoreductase family demonstrates significant structural conservation despite sequence divergence, as seen in studies of the human and mouse QR1 enzymes . Similar approaches applied to the ndhE protein from Nephroselmis could reveal important evolutionary patterns in chloroplast electron transport systems.

What functional assays can be used to characterize the ndhE protein activity?

Characterizing the functional activity of the ndhE protein requires specialized assays that account for its role in the multisubunit NDH complex. Recommended assays include:

  • Reconstitution assays: Incorporating purified recombinant ndhE into liposomes or nanodiscs along with other NDH complex subunits to measure electron transport activity.

  • Electron transport measurements: Using artificial electron donors and acceptors to monitor electron flow through the reconstituted complex containing ndhE.

  • Chlorophyll fluorescence analysis: In vivo measurements of NDH activity in wild-type versus ndhE-mutant organisms using pulse amplitude modulation (PAM) fluorometry to assess cyclic electron flow around PSI.

  • Proton gradient measurements: Using pH-sensitive fluorescent dyes to detect proton translocation across membranes in systems with functional versus non-functional ndhE.

  • Inhibitor studies: Examining the effects of specific NDH complex inhibitors on systems with wild-type versus modified ndhE to identify functional domains.

  • Isotope labeling experiments: Using isotope-labeled substrates to trace electron flow through the NDH complex containing ndhE under various conditions.

These assays should be performed under various light conditions and stress treatments to fully characterize the functional role of ndhE in photosynthetic and chlororespiratory processes.

What can be concluded from the presence of ndh genes in Nephroselmis olivacea compared to other algae?

This pattern of selective retention provides a valuable window into the evolutionary forces shaping chloroplast genomes across diverse photosynthetic lineages.

How does ndhE sequence conservation compare across different taxonomic groups?

Analysis of ndhE sequence conservation across taxonomic groups reveals a complex pattern of evolutionary constraints and adaptations:

Taxonomic GroupSequence Identity to N. olivacea ndhE (%)Notable Sequence Features
Early-diverging chlorophytes75-85%High conservation of transmembrane domains
Core chlorophytes (Chlorella, etc.)Gene absentN/A - Gene lost in these lineages
Charophyte algae60-70%Variable N-terminal region
Bryophytes55-65%Extended loop regions between conserved domains
Gymnosperms50-60%Higher variability, some species lack the gene
Angiosperms45-55%Most conserved in regions involved in subunit interactions

The higher sequence conservation between Nephroselmis and early-diverging chlorophytes compared to land plants supports the phylogenetic placement of Nephroselmis as an early branch within the Chlorophyta . The pattern of conservation is not uniform across the protein, with transmembrane domains and regions involved in cofactor binding showing higher conservation than peripheral regions. This differential conservation pattern likely reflects the functional constraints on specific protein domains involved in electron transport and structural integrity of the NDH complex.

How can CRISPR/Cas9 gene editing be applied to study ndhE function in Nephroselmis olivacea?

Applying CRISPR/Cas9 gene editing to study ndhE function in Nephroselmis olivacea requires specialized approaches due to the unique characteristics of this organism and its chloroplast genome:

  • Development of transformation protocols: Establish efficient methods for introducing the CRISPR/Cas9 components into Nephroselmis cells, potentially using electroporation, biolistic delivery, or Agrobacterium-mediated transformation adapted for algal systems.

  • Chloroplast-targeted CRISPR system: Design a nuclear-encoded Cas9 with a chloroplast transit peptide to ensure localization to the chloroplast compartment where ndhE is encoded.

  • sgRNA design for chloroplast genomes: Target unique sites in the ndhE gene while accounting for the polyploid nature of chloroplast genomes (multiple copies must be edited for observable phenotypes).

  • Homology-directed repair templates: Design repair templates containing desired modifications (point mutations, deletions, or reporter gene insertions) flanked by homologous sequences to facilitate precise editing.

  • Selection strategy: Develop appropriate selection methods for identifying transformants with edited chloroplast genomes, potentially using antibiotic resistance markers specifically engineered for chloroplast expression.

  • Verification of homoplasmy: Implement strategies to ensure complete replacement of all wild-type chloroplast genome copies with the edited version.

  • Phenotypic analysis: Conduct comprehensive phenotypic characterization of ndhE mutants under various light intensities, CO2 concentrations, and abiotic stress conditions to determine functional impacts.

This approach would provide direct evidence for the role of ndhE in Nephroselmis and could be extended to create a series of mutations targeting different functional domains of the protein.

What are the challenges and potential solutions in analyzing the NDH complex assembly in Nephroselmis olivacea?

Analyzing NDH complex assembly in Nephroselmis olivacea presents several technical challenges with corresponding potential solutions:

ChallengePotential Solution
Lack of established protocols for Nephroselmis cultivationOptimize growth conditions based on related prasinophyte algae; develop defined media for consistent growth
Limited availability of antibodies against Nephroselmis proteinsDevelop custom antibodies against conserved epitopes or use epitope tagging of proteins through genetic engineering
Complex membrane integration of NDH subunitsEmploy specialized detergents (digitonin, DDM) for gentle solubilization; use native electrophoresis techniques
Low abundance of NDH complexImplement affinity purification approaches; consider inducible overexpression systems
Multiple assembly intermediatesUse pulse-chase labeling combined with blue native PAGE to track assembly progression
Differentiation from respiratory complex IDevelop chloroplast isolation protocols specific for Nephroselmis; use spectroscopic methods to distinguish complexes
Inter-species variation in complex compositionPerform comparative proteomic analyses with other species containing ndh genes

Additionally, researchers should consider employing cryo-electron microscopy for structural characterization of the intact complex, which can provide insights into subunit arrangements and assembly interfaces without requiring crystallization. Cross-linking mass spectrometry approaches can also identify interaction partners of ndhE during the assembly process, helping to establish the assembly pathway of this ancient photosynthetic complex.

How does the NDH complex containing ndhE contribute to photosynthetic efficiency under different environmental conditions?

The NDH complex containing ndhE contributes to photosynthetic efficiency through several mechanisms that vary in importance under different environmental conditions:

  • Low light conditions: The NDH complex enhances cyclic electron flow around Photosystem I, generating additional ATP without producing NADPH, thus optimizing the ATP/NADPH ratio for carbon fixation when light is limiting .

  • High light stress: During excess light exposure, the NDH complex helps dissipate excess excitation energy, protecting the photosynthetic apparatus from photodamage by increasing non-photochemical quenching.

  • CO2 limitation: Under conditions of limited CO2 availability, the NDH complex contributes to carbon concentration mechanisms by energizing inorganic carbon uptake through provision of additional ATP.

  • Temperature stress: The NDH-mediated cyclic electron transport becomes increasingly important during temperature extremes, helping maintain photosynthetic efficiency when enzymatic reactions of carbon fixation are compromised.

  • Transition between light and dark: During light-dark transitions, the NDH complex participates in chlororespiration, oxidizing stromal reductants and maintaining redox balance when photosynthesis is not active .

Research suggests that the NDH complex is dispensable under optimal growth conditions but becomes increasingly important under environmental stress . The retention of ndh genes in Nephroselmis despite their loss in many other algal lineages suggests this early-diverging green alga may occupy ecological niches where NDH function provides a significant adaptive advantage.

What role might ndhE play in the adaptation of Nephroselmis olivacea to its specific ecological niche?

The retention of ndhE in Nephroselmis olivacea, despite its loss in many other algal lineages, suggests this gene plays a specialized role in the adaptation of this organism to its ecological niche:

  • Habitat adaptation: Nephroselmis species typically inhabit shallow marine and freshwater environments with fluctuating light conditions. The ndhE-containing NDH complex may facilitate rapid photosynthetic adjustments to changing light availability in these dynamic environments.

  • Resource allocation: The maintenance of ndhE and other ndh genes represents a significant genomic investment. Its retention in Nephroselmis suggests the functional benefits outweigh the metabolic costs of maintaining these genes in the chloroplast genome.

  • Stress tolerance: The NDH complex may provide Nephroselmis with enhanced resilience to multiple stressors common in its natural habitats, such as fluctuating salinity, temperature variations, and changing nutrient availability.

  • Evolutionary advantage: The presence of a functional NDH complex may have provided Nephroselmis with competitive advantages during early green algal evolution, contributing to its successful adaptation and persistence while other lineages evolved alternative mechanisms.

  • Metabolic flexibility: The NDH complex could enhance metabolic flexibility by allowing fine-tuning of the ATP/NADPH ratio produced during photosynthesis, enabling more efficient allocation of resources under variable environmental conditions.

The unique retention pattern of ndh genes in Nephroselmis provides an excellent model system for studying the evolutionary forces driving chloroplast genome reduction and the specific ecological pressures that maintain certain gene sets in photosynthetic organisms.

What are the most promising directions for future research on Nephroselmis olivacea ndhE?

Future research on Nephroselmis olivacea ndhE should focus on several promising directions that could significantly advance our understanding of chloroplast evolution and function:

  • Comparative functional genomics: Systematic comparison of ndhE function between Nephroselmis and land plants to determine if the protein serves identical or divergent roles across these distantly related lineages.

  • Environmental adaptation studies: Investigation of ndhE expression and NDH complex activity under defined environmental stressors to determine the ecological significance of retaining this gene.

  • Protein structure determination: Resolving the structure of the Nephroselmis NDH complex through cryo-electron microscopy to provide insights into the ancient structural features of this complex.

  • Synthetic biology approaches: Creating chimeric NDH complexes with subunits from different evolutionary lineages to determine compatibility and functional conservation.

  • Horizontal gene transfer investigation: Examining whether horizontal gene transfer played any role in the unusual distribution pattern of ndh genes across algal lineages.

  • Coordination with nuclear genome: Studying the co-evolution of nuclear-encoded partners of the NDH complex with the chloroplast-encoded ndhE.

  • Application to biofuel production: Exploring how manipulation of ndhE and the NDH complex could enhance photosynthetic efficiency in algal biofuel production systems.

These research directions would not only advance our understanding of Nephroselmis biology but would also contribute significantly to broader questions in chloroplast evolution, photosynthesis optimization, and algal biotechnology.

How might advanced imaging techniques contribute to our understanding of ndhE localization and function?

Advanced imaging techniques offer powerful approaches to elucidate ndhE localization and function within the chloroplast of Nephroselmis olivacea:

These advanced imaging techniques, especially when combined with specific labeling strategies and genetic manipulations, will provide unprecedented insights into how this ancient protein functions within the complex three-dimensional architecture of the chloroplast.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.