Recombinant Nephroselmis olivacea Peptidoglycan synthase ftsI homolog (ftsI)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
ftsI; Peptidoglycan D,D-transpeptidase FtsI homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-709
Protein Length
full length protein
Species
Nephroselmis olivacea (Green alga)
Target Names
ftsI
Target Protein Sequence
MIYNYPMKYRRQFRRLPKHLQGIYYAFLSISTMIKIALDPYSKRPMKWMHSGTPFQYENE RMVMIKLSLATVGLLFATRLSGLQFNKYTELKSVAERQQIGQVNDPQQRKIILDHHGDIV AIDLPAYDLYVHPRMCSISLERIAELLSPILDLSSQYLYNRLDEGDSGICLMHQIDTNTS AQIRRLGVDGIELVHHPQRVYPKRGSFESILGYVDTEGYGQAGLESSLDDWMKSTYQDVP CWMDGHGNFLGIRFPKQILFHQESALQLTIDCGLQEKVSQLITNAMNRFGAKRIAAIIME AHSGAIRCLATSPSYDPNCYGWFPMERFRCWPITDLFEPGSTFKPVNLAIALENGIFQPT DRILDTGKIRIGDSWIGNVGGGFIWDRSLDHLTGTQILQRSSNVGMVRVMQSLDPAIYHR NLIRLGLGSHRNDNQTSFKMSSHDHNESGWNLKDLTSDYAISVVKDQDEFVDHEIEAATA SFGQGLAMTPLKLLQLIATIANGGMAVTPHLISKIVTLDHFHHLQSMNEFSLQGWVGQSV LSRSQYHAKQPRPYTHDLYLGHVPVPSLELGWFDVKSIPPHTRERRRLFSRQTCNVLLGM LEQVVLDAQATGSRGFLPGYAMAGKTGTAQKASALGGYSTDSVVTSFVGIYPAVKPKFVT LVIIDEPEDPFRFGFNTAVDVTQTLISEMIVQEQDPPSYPTVSLFERNM
Uniprot No.

Target Background

Protein Families
Transpeptidase family
Subcellular Location
Plastid, chloroplast membrane; Single-pass membrane protein.

Q&A

What is Nephroselmis olivacea and why is its ftsI homolog significant?

Nephroselmis olivacea is a freshwater green alga belonging to the Nephrophyceae class (Prasinophyceae), thought to include descendants of the earliest-diverging green algae. The presence of the ftsI gene in its chloroplast genome is highly significant because in bacteria, FtsI (also called PBP3) catalyzes peptidoglycan layer synthesis during septum formation. This was unexpected since chloroplast envelopes of green algae were not previously reported to contain any peptidoglycan layer. The discovery suggests that a peptidoglycan layer or vestige of this layer may be more widespread in algal chloroplasts than previously documented .

What is the evolutionary significance of finding bacterial cell division proteins in chloroplast genomes?

The presence of bacterial cell division proteins (ftsI, ftsW, minD, and minE) in the N. olivacea chloroplast genome provides evidence for the endosymbiotic theory of chloroplast evolution. These genes, particularly ftsI and ftsW, are involved in peptidoglycan synthesis and septum formation in bacteria. Their presence in N. olivacea, along with the finding that N. olivacea and land plant chloroplast DNAs share the same quadripartite structure, suggests that these structural characteristics were likely present in the chloroplast DNA of the common ancestor of chlorophytes and streptophytes. This indicates that the typical quadripartite architecture and gene-partitioning pattern seen in land plant chloroplast DNAs are ancient features potentially derived from the genome of the cyanobacterial progenitor of chloroplasts .

How does FtsI function in bacterial systems, and what can this tell us about its potential role in chloroplasts?

In bacterial systems, FtsI (also known as PBP3) is a penicillin-binding protein that functions as a transpeptidase, catalyzing the cross-linking of peptidoglycan during septum formation in cell division. It is part of the divisome complex that assembles at the future division site, where the FtsZ protein forms a ring-like structure.

Studies in Escherichia coli have shown that inactivation of FtsI inhibits constriction of the FtsZ cytokinetic ring. When FtsI is inactivated using β-lactams like cephalexin or through temperature-sensitive mutations, cells form filaments without division septa. This indicates that the transpeptidase activity of FtsI is required for FtsZ ring constriction and subsequent cell division .

The presence of ftsI in N. olivacea suggests that a peptidoglycan synthesis mechanism may exist in its chloroplasts, potentially playing a role in chloroplast division. This is supported by the co-occurrence of other cell division genes (ftsW, minD, minE) in the N. olivacea chloroplast genome .

What other unique genes are found in the N. olivacea chloroplast genome alongside ftsI?

Besides ftsI, several other unique genes were identified in the N. olivacea chloroplast genome:

  • ycf81 - A gene of unknown function, previously only identified in bacterial genomes

  • ftsW - Another gene involved in peptidoglycan synthesis and septum formation

  • rnE - Found only in non-green algal chloroplast DNAs prior to this discovery

  • ycf62 - Found only in non-green algal chloroplast DNAs prior to this discovery

  • rnpB - Found only in non-green algal chloroplast DNAs prior to this discovery

  • trnS(cga) - Found only in non-green algal chloroplast DNAs prior to this discovery

  • ndh genes (ndhA-K, except ndhJ) - Previously described only in land plant chloroplast DNAs

  • minD and minE - Involved in regulation of division site placement

The presence of these genes, particularly the ndh genes and those involved in peptidoglycan synthesis, makes the N. olivacea chloroplast genome unique among green algae and provides insights into chloroplast evolution .

What are the recommended protocols for expressing and purifying recombinant N. olivacea FtsI?

For expression and purification of recombinant N. olivacea FtsI:

  • Expression System: The protein is typically expressed in E. coli as a host organism with an N-terminal His-tag.

  • Expression Vector Construction:

    • Clone the full-length ftsI gene (1-709 amino acids) into an appropriate expression vector

    • Include an N-terminal His-tag sequence for purification

    • Ensure proper codon optimization for E. coli expression

  • Protein Expression:

    • Transform the expression construct into a suitable E. coli strain

    • Culture in appropriate media (typically LB with antibiotic selection)

    • Induce expression using IPTG (typically 0.5-1 mM)

    • Grow at lower temperatures (16-25°C) post-induction to enhance soluble protein production

  • Purification:

    • Harvest cells and lyse using appropriate buffer systems

    • Purify using nickel affinity chromatography

    • Consider additional purification steps like ion-exchange or size-exclusion chromatography

    • For highly purified preparations, aim for greater than 90% purity as determined by SDS-PAGE

  • Storage:

    • Store in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • For long-term storage, add glycerol (final concentration 5-50%) and store at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • Consider working aliquots at 4°C for up to one week

What methodologies are used to study the function of FtsI in chloroplasts versus bacteria?

Several methodologies can be employed to study FtsI function in chloroplasts compared to bacteria:

  • Genetic Approaches:

    • Generate knockout or temperature-sensitive mutants of ftsI in both systems

    • Use CRISPR-Cas9 for targeted gene editing in N. olivacea

    • Create chimeric constructs by swapping domains between bacterial and chloroplast FtsI proteins

  • Localization Studies:

    • Fluorescent protein fusions (GFP-FtsI) to track localization during chloroplast division

    • Immunofluorescence microscopy with anti-FtsI antibodies

    • Co-localization studies with other division proteins (FtsZ, FtsW)

  • Biochemical Assays:

    • Penicillin-binding assays using fluorescent β-lactams (e.g., Bocillin FL)

    • In vitro transpeptidase activity assays with purified protein

    • Thermal stability assays to assess protein folding and stability

  • Structural Biology:

    • X-ray crystallography or cryo-EM to determine protein structure

    • Comparative analysis with bacterial FtsI structures

    • Molecular dynamics simulations to study domain movements

  • Interaction Studies:

    • Pull-down assays to identify protein-protein interactions

    • Bacterial two-hybrid or yeast two-hybrid screens

    • Co-immunoprecipitation with other division proteins

How can the peptidoglycan layer be detected in chloroplasts of N. olivacea?

Detecting a potential peptidoglycan layer in N. olivacea chloroplasts requires specialized techniques:

  • Electron Microscopy Approaches:

    • Transmission electron microscopy (TEM) with specific staining protocols for peptidoglycan

    • Cryo-electron tomography to visualize native structures

    • Immunogold labeling using antibodies against peptidoglycan components

  • Biochemical Detection Methods:

    • Isolation of chloroplasts and extraction of cell wall components

    • Analysis of muramic acid and diaminopimelic acid (DAP) content by HPLC

    • Mass spectrometry analysis of peptidoglycan fragments

  • Fluorescent Probes:

    • Use of fluorescent D-amino acids (FDAAs) that incorporate into newly synthesized peptidoglycan

    • Vancomycin-BODIPY or similar probes that bind to peptidoglycan

  • Enzymatic Susceptibility:

    • Treatment with lysozyme or muramidases that specifically degrade peptidoglycan

    • Analysis of chloroplast integrity and morphology following enzyme treatment

  • Genetic Approaches:

    • Knockout or inhibition of ftsI and other peptidoglycan synthesis genes

    • Observation of resulting phenotypes in chloroplast envelope structure

These approaches would need to be adapted specifically for N. olivacea, taking into account its small cell size and unique chloroplast structure .

How do the functional domains of N. olivacea FtsI compare to those of bacterial FtsI proteins, and what implications might this have for its activity?

A detailed comparison of N. olivacea FtsI with bacterial homologs reveals several key aspects:

Comparative modeling with well-characterized bacterial FtsI structures, combined with molecular dynamics simulations, could provide insights into these structural and functional differences .

What evolutionary scenarios might explain the presence of ftsI in N. olivacea but its absence in most other green algae?

Several evolutionary scenarios could explain the unique distribution pattern of the ftsI gene:

  • Differential Gene Loss Hypothesis:

    • The cyanobacterial endosymbiont that gave rise to chloroplasts contained ftsI and other peptidoglycan synthesis genes

    • These genes were retained in the early chloroplast genome

    • Selective pressure led to gene loss in most lineages as the peptidoglycan layer became vestigial

    • N. olivacea represents a basal lineage that retained these genes while they were lost in other chlorophytes

  • Functional Repurposing Hypothesis:

    • The ftsI gene may have acquired new functions in N. olivacea

    • This functional shift provided selective advantage for retention

    • In other lineages, without functional shifts, the gene was lost

  • Horizontal Gene Transfer Scenario:

    • N. olivacea may have reacquired ftsI through horizontal gene transfer

    • This could explain why the gene is present in this species but absent in close relatives

  • Environmental Adaptation Hypothesis:

    • The freshwater habitat of N. olivacea may have provided selective pressure to maintain aspects of peptidoglycan synthesis

    • Marine species might have faced different selective pressures

Phylogenetic analysis of ftsI sequences across diverse lineages of bacteria, cyanobacteria, and the few algae that possess it could help distinguish between these scenarios. The shared presence of ftsI, ftsW, and other peptidoglycan-related genes suggests the differential gene loss scenario is most likely .

What are the implications of studying N. olivacea FtsI for understanding chloroplast division mechanisms?

Studying N. olivacea FtsI has profound implications for understanding chloroplast division:

  • Evolutionary Perspective on Plastid Division:

    • The presence of bacterial cell division genes (ftsI, ftsW, minD, minE) in N. olivacea provides evidence for the gradual transformation of bacterial cytokinesis machinery into chloroplast division machinery

    • Comparison with other plastid division systems could reveal the stepwise evolution of this process

  • Mechanistic Insights:

    • FtsI study could reveal whether peptidoglycan synthesis plays any role in chloroplast division of basal green algae

    • This may help resolve whether the FtsZ-based division system in chloroplasts requires peptidoglycan remodeling, as it does in bacteria

  • Potential Novel Division Components:

    • Investigation of FtsI interactors in N. olivacea might reveal previously unknown components of the chloroplast division machinery

    • These components could represent evolutionary intermediates between bacterial and modern plant plastid division systems

  • Medical and Biotechnological Applications:

    • Understanding the relationship between bacterial and plastid FtsI proteins could inform development of antibiotics targeting bacterial FtsI without affecting plastid function

    • Engineering of chloroplast division machinery for biotechnological applications

  • Endosymbiotic Theory Refinement:

    • The pattern of gene retention/loss related to peptidoglycan synthesis across algal lineages provides a model system for studying endosymbiotic gene transfer and loss

This research would benefit from comparative studies with the few other algal species that retain peptidoglycan synthesis genes, such as Mesostigma viride and Chlorokybus atmophyticus, which also possess ftsI homologs .

How might studying the interaction between FtsI and FtsZ in N. olivacea inform our understanding of chloroplast division regulation?

Investigating FtsI-FtsZ interactions in N. olivacea would provide unique insights into chloroplast division regulation:

  • Mechanistic Coupling Analysis:
    In bacteria, FtsZ ring constriction requires the transpeptidase activity of FtsI. Studies in E. coli have shown that inactivation of FtsI using β-lactams or temperature-sensitive mutations results in unconstricted FtsZ rings trapped at the midpoint of the cell. A similar analysis in N. olivacea could reveal:

    • Whether chloroplast FtsZ constriction depends on FtsI activity

    • If this dependency represents an ancestral feature of plastid division

    • How this relationship has evolved in a chloroplast environment

  • Recruitment Dependency Assessment:
    Bacterial studies suggest FtsI may influence FtsZ ring assembly, as some ftsI mutant filaments display defects in FtsZ assembly. In N. olivacea:

    • Time-course localization studies could determine the temporal sequence of FtsI and FtsZ recruitment

    • Inhibition of FtsI using specific inhibitors could reveal effects on FtsZ dynamics

    • This would clarify whether FtsI influences FtsZ assembly in chloroplasts as it might in bacteria

  • Divisome Architecture Comparison:

    • Protein-protein interaction studies could map the chloroplast divisome architecture in N. olivacea

    • This would reveal whether the spatial organization of division proteins resembles the bacterial divisome

    • Differences would highlight evolutionary adaptations specific to chloroplast division

  • Regulatory Pathway Integration:

    • Analysis of how FtsI and FtsZ activities are coordinated with other division components (MinD, MinE, FtsW)

    • Investigation of potential chloroplast-specific regulators of this process

These studies would require advanced microscopy techniques, possibly including super-resolution approaches, to visualize the small chloroplast division machinery components, combined with genetic and biochemical approaches to manipulate FtsI activity .

What experimental challenges must be overcome when working with recombinant N. olivacea FtsI, and what are potential solutions?

Working with recombinant N. olivacea FtsI presents several experimental challenges:

  • Protein Solubility and Stability Issues:
    Challenge: As a membrane-associated protein with a transmembrane domain, FtsI can be difficult to express in soluble form.
    Solutions:

    • Express truncated versions lacking the transmembrane domain

    • Use specialized detergents for membrane protein solubilization

    • Employ fusion tags that enhance solubility (MBP, SUMO)

    • Express at lower temperatures (16-18°C) to improve folding

    • Supplement expression media with specific chaperones

  • Enzymatic Activity Assessment:
    Challenge: The natural substrates and exact function in chloroplasts remain unknown.
    Solutions:

    • Adapt bacterial transpeptidase assays using fluorescent β-lactams like Bocillin FL

    • Develop in vitro peptidoglycan synthesis assays using defined substrates

    • Use site-directed mutagenesis of conserved catalytic residues to correlate structure with function

    • Employ mass spectrometry to identify potential chloroplast peptidoglycan structures

  • Crystallization Difficulties:
    Challenge: Membrane proteins are notoriously difficult to crystallize.
    Solutions:

    • Use lipidic cubic phase crystallization techniques

    • Screen multiple detergents and buffer conditions

    • Consider cryo-EM as an alternative structural approach

    • Focus on the catalytic domain for initial crystallization attempts

  • Heterologous Expression System Limitations:
    Challenge: E. coli expression systems may not provide proper folding or post-translational modifications.
    Solutions:

    • Test multiple expression hosts (yeast, insect cells)

    • Co-express with chloroplast-specific chaperones

    • Consider cell-free expression systems

  • Functional Validation in Native Context:
    Challenge: Genetic manipulation of N. olivacea is not well-established.
    Solutions:

    • Develop transformation protocols specific for N. olivacea

    • Use heterologous complementation in bacterial systems

    • Employ specific inhibitors to assess function in vivo

Storage protocols for the purified protein should include stabilizing agents like trehalose (6%) and glycerol (5-50%), with storage at -80°C and minimal freeze-thaw cycles to maintain activity .

How does N. olivacea FtsI compare to FtsI homologs found in other green algae such as Mesostigma viride and Chlorokybus atmophyticus?

A comparative analysis of FtsI homologs across green algae species reveals important evolutionary patterns:

FeatureNephroselmis olivacea FtsIMesostigma viride FtsIChlorokybus atmophyticus FtsI
Protein Length709 amino acids598 amino acids679 amino acids
Cellular LocationChloroplast-encodedChloroplast-encodedChloroplast-encoded
Evolutionary PositionEarly-diverging chlorophyteBasal streptophyteBasal streptophyte
Conserved DomainsTransmembrane domain, non-catalytic domain, transpeptidase domainSimilar domain architecture with sequence divergenceSimilar domain architecture with sequence divergence
Associated Division GenesftsW, minD, minE present in chloroplast genomeSimilar set of division genesSimilar set of division genes

These three species represent some of the earliest diverging lineages of green algae, with Nephroselmis belonging to the Chlorophyta and Mesostigma and Chlorokybus belonging to the Streptophyta. The presence of ftsI in all three suggests it was present in the common ancestor of all green plants.

Sequence analysis would likely reveal higher conservation in the catalytic transpeptidase domain compared to other regions. Differences in sequence and domain organization might reflect adaptation to specific chloroplast environments and division mechanisms in each lineage.

The retention of ftsI specifically in these basal lineages, while it was lost in more derived green algae, suggests it represents an ancestral feature that was subsequently eliminated in most green plant lineages .

What are the implications of finding peptidoglycan synthesis genes in algal chloroplast genomes for antibiotic development?

The presence of peptidoglycan synthesis genes in algal chloroplasts has significant implications for antibiotic development:

  • Potential Off-Target Effects:

    • β-lactam antibiotics target bacterial peptidoglycan synthesis proteins, including FtsI

    • If algal FtsI proteins retain similar structures and functions, these antibiotics might affect algae containing these proteins

    • This could have ecological implications when antibiotics enter aquatic environments

  • Differential Sensitivity Analysis:

    • Comparative studies of bacterial and algal FtsI sensitivity to various antibiotics could reveal:

      • Structural differences in the antibiotic binding pockets

      • Evolutionary adaptations that might confer natural resistance

      • Classes of antibiotics with minimal impact on algal FtsI

  • Ecological Risk Assessment:

    • Understanding which algal species retain functional peptidoglycan synthesis machinery would help assess ecological risks of antibiotics in aquatic environments

    • This is particularly relevant for basal green algae that may retain more complete peptidoglycan synthesis pathways

  • Novel Antibiotic Development:

    • Structural differences between bacterial and algal FtsI could be exploited to design antibiotics that selectively target bacteria

    • This would minimize potential ecological impacts on algal communities

  • Evolutionary Insights for Drug Design:

    • Understanding how FtsI structure and function has evolved across different lineages could inform rational drug design strategies

    • Targeting highly conserved features would increase broad-spectrum activity

    • Targeting lineage-specific features would increase specificity

These implications highlight the importance of comparative studies between bacterial and algal peptidoglycan synthesis proteins for both ecological risk assessment and antibiotic development .

What future research directions should be prioritized to advance our understanding of peptidoglycan synthesis in green algae?

Several high-priority research directions would significantly advance our understanding of peptidoglycan synthesis in green algae:

  • Comprehensive Survey of Peptidoglycan Presence:

    • Develop and apply sensitive detection methods to determine if peptidoglycan or its derivatives exist in chloroplasts of N. olivacea and other basal green algae

    • Use mass spectrometry, specific staining techniques, and immunodetection methods to characterize any peptidoglycan-like structures

  • Functional Characterization of FtsI Activity:

    • Determine if N. olivacea FtsI possesses transpeptidase activity in vitro

    • Identify the natural substrates and products of this enzyme in the chloroplast context

    • Establish whether the activity is essential for chloroplast division or maintenance

  • Evolutionary Genomics Approach:

    • Expand chloroplast genome sequencing efforts to more basal green algae species

    • Perform phylogenomic analyses of peptidoglycan synthesis genes to refine our understanding of when and how many times these genes were lost

    • Investigate potential cases of horizontal gene transfer that might explain unusual distribution patterns

  • Development of Genetic Manipulation Systems:

    • Establish transformation protocols for N. olivacea and other basal green algae

    • Create targeted gene knockout or modification systems to directly test functions of peptidoglycan synthesis genes

    • Develop conditional expression systems to study essential genes

  • Structural Biology Initiative:

    • Determine high-resolution structures of algal FtsI proteins

    • Compare with bacterial counterparts to identify structural adaptations

    • Use structure-guided approaches to probe function

  • Integration with Chloroplast Division Studies:

    • Investigate the relationship between peptidoglycan synthesis and the established chloroplast division machinery

    • Determine if peptidoglycan synthesis is temporally or spatially coordinated with division events

    • Explore how the peptidoglycan synthesis machinery was replaced or modified in higher plants

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.