Recombinant Nephroselmis olivacea Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Nephroselmis olivacea Photosystem I Assembly Protein Ycf4

The Recombinant Nephroselmis olivacea Photosystem I assembly protein Ycf4 (ycf4) is a recombinant protein derived from the green alga Nephroselmis olivacea. This protein is involved in the assembly of Photosystem I (PSI), a crucial component of the photosynthetic apparatus in chloroplasts. PSI is essential for the light-dependent reactions of photosynthesis, where light energy is converted into chemical energy.

Characteristics of Recombinant Ycf4 from Nephroselmis olivacea

  • Species: The recombinant Ycf4 protein is derived from Nephroselmis olivacea, a green alga.

  • Sequence Information: The amino acid sequence of Ycf4 from Nephroselmis olivacea is available, providing insights into its structure and potential functions .

  • Storage and Handling: The recombinant protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C to maintain stability .

Research Findings and Applications

Research on Ycf4 has primarily focused on its role in PSI assembly and its interaction with other proteins. In Chlamydomonas, Ycf4 forms a complex with COP2 and PSI subunits, suggesting a scaffold role in PSI assembly . In higher plants, while not essential, Ycf4 contributes to efficient PSI biogenesis .

Table: Characteristics of Recombinant Nephroselmis olivacea Ycf4

CharacteristicDescription
SpeciesNephroselmis olivacea
FunctionPSI assembly protein
Sequence Length183 amino acids
Storage ConditionsTris-based buffer, 50% glycerol, -20°C
Protein TypeRecombinant protein

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4; RF4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Nephroselmis olivacea (Green alga)
Target Names
ycf4
Target Protein Sequence
MDTTNLVRRDIVIGSRRVSNYWWASVLLLGGSSFLVVGLSSRLGFDLVPFLPAGDIIFIP QGLVMCFYGLVGLVVSTYLWLTILWSVGGGYNEFNKQEGVMRIFRWGFPGRDRRIQLTCP LQDIEAIRVELQEGMNPRRTIYVRLKGKREVPLTRIGQPLTLAEIEKQAAELAGFLQVSL EGF
Uniprot No.

Target Background

Function
Appears essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the Function of Ycf4 in Photosynthetic Organisms?

Ycf4 is an essential thylakoid membrane protein that functions as a scaffold for photosystem I (PSI) assembly in photosynthetic organisms. Research demonstrates that Ycf4:

  • Stabilizes intermediate subcomplexes during PSI assembly, particularly those containing the PsaAB heterodimer and stromal subunits PsaCDE

  • Facilitates the addition of the PsaF subunit to this subcomplex

  • Forms a large complex (>1500 kD) that includes newly synthesized PSI polypeptides

  • Is critical for the accumulation of PSI in green algae like Chlamydomonas reinhardtii, as knockout studies show complete loss of PSI activity in its absence

  • Shows species-specific functional importance; complete knockout in tobacco prevents photoautotrophic growth , while in cyanobacteria (Synechocystis), mutants can still assemble PSI but at reduced levels

The significance of Ycf4 is highlighted by the inability of ycf4-deficient organisms to grow photoautotrophically, demonstrating its crucial role in photosynthesis.

How is the ycf4 Gene Organized in the Chloroplast Genome of Nephroselmis olivacea?

The ycf4 gene in Nephroselmis olivacea is part of a well-characterized genomic structure:

  • Located within the complete chloroplast DNA sequence of 200,799 bp

  • Resides in a genome with quadripartite structure featuring a large rRNA-encoding inverted repeat (IR) and two unequal single-copy regions

  • The gene encodes a protein of 184 amino acids, which is highly conserved in sequence and length across many photosynthetic organisms

  • In other organisms like Chlamydomonas reinhardtii, ycf4 is co-transcribed with other genes as part of the rps9–ycf4–ycf3–rps18 polycistronic transcriptional unit

The position of ycf4 within the chloroplast genome suggests its ancient evolutionary history and importance to photosynthetic function.

What Methodologies are Used to Study Ycf4 Function in Photosystem I Assembly?

Researchers employ several sophisticated methodologies to investigate Ycf4:

Genetic Approaches:

  • Targeted gene disruption via biolistic transformation with selectable markers (e.g., aadA cassette conferring spectinomycin resistance)

  • Complete gene knockout versus partial disruption to investigate domain-specific functions

  • Generation of TAP-tagged (tandem affinity purification) Ycf4 strains for protein complex purification

Biochemical Analysis:

  • Two-step affinity column chromatography for purification of Ycf4-containing complexes

  • Sucrose gradient ultracentrifugation and ion exchange chromatography to identify interacting partners

  • Mass spectrometry (liquid chromatography–tandem mass spectrometry) for protein identification

  • Immunoblotting for protein detection and quantification

Structural and Functional Studies:

  • Electron microscopy for visualization of purified Ycf4 complexes

  • Fluorescence induction kinetics to assess PSI activity in mutants

  • Pulse-chase protein labeling to track newly synthesized PSI polypeptides

  • Transmission electron microscopy (TEM) to study ultrastructural variations in chloroplasts of knockout plants

These methodologies collectively enable comprehensive analysis of Ycf4's role in PSI assembly and photosynthetic function.

How Does Ycf4 Interact with Other Proteins During Photosystem I Assembly?

Ycf4 forms a large complex and interacts with multiple partners during PSI assembly:

  • Forms a stable complex of >1500 kD containing the opsin-related COP2 protein and PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF

  • Interacts with newly synthesized PSI polypeptides that are partially assembled as a pigment-containing subcomplex

  • Protein-protein interaction studies suggest the C-terminal region of Ycf4 (91 amino acids) is particularly important for interactions with PSI subunits

  • In silico studies reveal strong interactions between the carboxyl terminus of Ycf4 and photosystem-I subunits psaB, psaC, psaH, and light-harvesting complex (LHC)

  • The Ycf4 complex acts as a scaffold during PSI assembly, mediating interactions between newly synthesized PSI polypeptides

This network of interactions explains why Ycf4 is essential for proper PSI assembly and why even partial disruption can affect photosynthetic efficiency.

What are the Evolutionary Patterns of the ycf4 Gene Across Different Plant Lineages?

The ycf4 gene shows fascinating evolutionary patterns across plant lineages:

  • Highly conserved in sequence and function across cyanobacteria, green algae, and land plants

  • In Nephroselmis olivacea (an early-diverging green alga), ycf4 shows similar organization to land plants, suggesting an ancient origin

  • Experiences dramatic acceleration of evolutionary rate in legumes (Fabaceae), particularly in the Papilionoideae subfamily

  • In the genus Lathyrus, ycf4 exhibits a localized mutation hotspot with mutation rates at least 20-fold higher than the rest of the genome

  • Has been lost or pseudogenized in some legume species (e.g., Pisum sativum, some Desmodium species, Clitoria ternatea)

  • Shows expansion in protein size in some legumes, reaching 340 amino acids in Lathyrus latifolius and Lathyrus cirrhosus compared to the typical 184-185 amino acids

Branch-site model analysis identified seven codon sites in the ycf4 gene with posterior probabilities ≥95% that evolved under positive selective pressure specifically on the Lathyrus branch :

Codon PositionAmino Acid
1L
2S
3V
4V
5L
6L
7T

These evolutionary patterns make ycf4 an excellent model for studying chloroplast genome evolution and adaptation.

How Does Deletion or Mutation of ycf4 Affect Photosynthetic Efficiency in Different Organisms?

The effects of ycf4 deletion vary significantly across species:

In Chlamydomonas reinhardtii:

  • Complete loss of PSI activity

  • Inability to grow photoautotrophically

  • Specific loss of PSI complex while other thylakoid protein complexes (PSII, cytochrome b6/f complex, ATP synthase, LHC) remain unaffected

In Tobacco (Nicotiana tabacum):

  • Complete knockout prevents photoautotrophic growth

  • Plants show stunted growth even with sucrose supplementation

  • Chloroplast ultrastructure is altered: smaller, rounded chloroplasts with less densely packed thylakoid membranes

  • Partial knockout (removing only 93 of 184 amino acids from N-terminus) permits modest autotrophic growth, highlighting the importance of the C-terminal domain

In Cyanobacteria (Synechocystis):

  • Less severe effects; PSI complex can still assemble but at reduced levels

  • Increased PSII/PSI ratio due to slight reduction in PSI amount

These species-specific differences suggest variation in the dependency on Ycf4 for PSI assembly and potential compensatory mechanisms in some organisms.

What is Known About the Hypermutation Pattern of ycf4 in Legumes?

The ycf4 gene in legumes, particularly in Lathyrus, exhibits extraordinary mutation patterns:

  • Forms a localized mutation hotspot with mutation rates at least 20-fold higher than the rest of the chloroplast genome

  • In Lathyrus latifolius and Lathyrus cirrhosus (closely related species with only 1 nucleotide difference in rbcL), there are 56 differences in the 1023-bp ycf4 sequence

  • The intergenic region between accD and ycf4 shows 10% divergence between these species

  • In L. latifolius, this spacer has expanded from 238bp to 648bp due to multiple tandem repeat sequences

  • Despite high mutation rates, functional constraint is still evident as nonsynonymous substitution rates remain lower than synonymous rates (dN/dS < 1)

  • Protein sequence divergence between Lathyrus species exceeds that between other angiosperms and cyanobacteria, despite much shorter divergence times

  • The transition/transversion ratio in the hypermutated region is approximately 0.9, suggesting no particular bias in mutation type

This hypermutation phenomenon violates the common assumption that point mutation rates are relatively constant across a genome, making ycf4 an important model for understanding localized hypermutation events.

How Can Recombinant Ycf4 Protein be Produced and Purified for Research Purposes?

Production of recombinant Ycf4 for research requires specialized techniques:

Expression Systems:

  • Bacterial expression systems (e.g., E. coli) can be used with codon optimization for the ycf4 gene

  • Chloroplast transformation in model organisms like Chlamydomonas or tobacco using biolistic transformation

  • For complex studies, expression of TAP-tagged Ycf4 in the native organism (e.g., Chlamydomonas) allows purification of functional complexes

Purification Methods:

  • Two-step affinity chromatography is effective for TAP-tagged proteins :

    • IgG agarose column adsorption

    • TEV protease digestion to remove Protein A domain

    • Calmodulin resin binding in presence of calcium ions

    • Elution with EGTA

Verification Techniques:

  • SDS-PAGE for purity assessment

  • Immunoblotting with Ycf4-specific antibodies

  • Mass spectrometry for protein identification

  • Functional assays to confirm activity

For structurally complex proteins like Ycf4 that form large assemblies, maintaining the native conformation during purification is essential for functional studies.

What are the Structural Characteristics of Ycf4 Protein?

The structural features of Ycf4 include:

  • Typically 184-185 amino acids long in most photosynthetic organisms

  • Contains two hydrophobic regions that could function as transmembrane helices

  • Despite having hydrophobic domains, biochemical studies show it is an extrinsic membrane protein rather than an integral membrane protein

  • Forms large complexes; electron microscopy of purified preparations reveals structures measuring 285 × 185 Å

  • In Chlamydomonas, the largest Ycf4-containing complex exceeds 1500 kD

  • The C-terminal region appears particularly important for protein-protein interactions and function

Understanding these structural characteristics is vital for elucidating Ycf4's role in PSI assembly and for designing experiments to study its function.

What are the Current Controversies or Unresolved Questions Regarding Ycf4 Function?

Despite extensive research, several aspects of Ycf4 function remain controversial or unresolved:

Essentiality across Species:

  • Why is Ycf4 absolutely essential in some organisms (Chlamydomonas) but less critical in others (cyanobacteria)?

  • What factors determine the severity of ycf4 knockout phenotypes across different photosynthetic lineages?

Secondary Functions:

  • Beyond PSI assembly, does Ycf4 serve additional functions? In Chlamydomonas, it has been found as a protein component of the eyespot

  • What is the functional significance of its interaction with the opsin-related COP2 protein?

Evolutionary Paradox:

  • How can ycf4 maintain its function in legumes despite extraordinary mutation rates?

  • What mechanisms drive the localized hypermutation in the ycf4 region of legume chloroplast genomes?

Structural Mechanisms:

  • What is the precise molecular mechanism by which Ycf4 facilitates PSI assembly?

  • How does the C-terminal domain contribute to Ycf4 function at the molecular level?

Hypermutation Consequences:

  • How does the hypermutation of ycf4 in legumes affect PSI assembly and photosynthetic efficiency?

  • Is there a connection between ycf4 hypermutation and the loss of the inverted repeat in the IRLC legumes?

These unresolved questions represent fertile ground for future research in understanding this fascinating component of the photosynthetic machinery.

What is the Subcellular Localization of Ycf4 Protein?

Ycf4 has a specific subcellular localization pattern:

  • Exclusively located in the chloroplast as a chloroplast genome-encoded protein

  • Associated with thylakoid membranes, which are the site of the photosynthetic light reactions

  • Despite containing hydrophobic regions that could act as transmembrane domains, biochemical studies indicate Ycf4 is an extrinsic membrane protein rather than an integral membrane protein

  • Treatment of thylakoid membranes with alkali or chaotropic agents can remove Ycf4, confirming its peripheral association

  • In sucrose gradient ultracentrifugation analysis, Ycf4 does not co-fractionate with PSI but is found in the bottom fractions, suggesting it forms part of a protein complex larger than PSI

  • In Chlamydomonas, a portion of Ycf4 is found in the eyespot structure of the chloroplast, indicating potential multiple localization patterns

This specific localization pattern is consistent with Ycf4's role in PSI assembly and emphasizes the importance of the thylakoid membrane environment for its function.

How Conserved is the ycf4 Gene Across Different Photosynthetic Organisms?

The ycf4 gene shows interesting patterns of conservation across photosynthetic organisms:

  • Highly conserved in sequence among cyanobacteria, green algae, and most land plants

  • In Nephroselmis olivacea (early-diverging green alga), Ycf4 displays 41-52% sequence identity with homologues from other algae, land plants, and cyanobacteria

  • The amino acid sequence is remarkably constant in length (184-185 amino acids) across most photosynthetic organisms

  • Conservation extends to genomic context; ycf4 is often found in conserved gene clusters across species

Shared chloroplast gene clusters containing ycf4 in Nephroselmis, Chlorella, and land plants:

Compared groupShared chloroplast gene clusters
Chlorellarpl23-rpl2-rps19-rps3-rpl16-rpl14-rpl5-rps8-infA-rpl36-rps11-rpoA-rps9-rpl12 C(gca)/rpoB-rpoC1-rpoC2 W(cca)-P(ugg)/psaJ-rps12-rps7-tufA-rpl19-ycf4 petA-petL-petG E(uuc)-rpl20 ycf5/chlL-chlN rpl32-cysT-ycf1
Land plantsycf4-cemA-petA

Notable exceptions to this conservation pattern include:

  • Legumes in the Papilionoideae subfamily show accelerated evolution of ycf4

  • In some legumes (e.g., Pisum sativum, certain Desmodium species), ycf4 has been lost or pseudogenized

  • In soybean and Lotus japonicus, the Ycf4 protein has expanded to about 200 residues

  • In Lathyrus species, Ycf4 reaches sizes of up to 340 amino acids

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.