Recombinant Nephroselmis olivacea Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

The recombinant CP47 is expressed in E. coli and purified via affinity chromatography. Critical production parameters include:

ParameterDetails
Expression SystemE. coli (optimized codon usage for heterologous expression)
TagN-terminal His tag for nickel-based purification
Purity>85% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer (pH 8.0) with 6% trehalose
Reconstitution0.1–1.0 mg/mL in sterile water; 50% glycerol recommended for long-term storage

Functional Role in Photosystem II

CP47 serves as an inner antenna complex in PSII, transferring excitation energy to the reaction center (D1/D2 heterodimer) . Key functional insights include:

  • Chlorophyll Binding: Binds 14–16 chlorophyll molecules, funneling energy to P680 .

  • Structural Stabilization: Interacts with PsbH and PsbT to maintain PSII core integrity .

  • Assembly Intermediates: Associates with Psb34 during RC47 (reaction center-CP47) assembly, preventing photodamage .

Studies using recombinant CP47 have clarified its role in PSII repair cycles and interactions with extrinsic proteins like PsbO and PsbV .

Applications in Research

This recombinant protein is utilized in:

  • Mechanistic Studies: Elucidating chlorophyll-protein interactions and energy transfer pathways .

  • Mutagenesis Analysis: Identifying residues critical for PSII assembly (e.g., Mn4_4CaO5_5 cluster binding) .

  • Antibody Production: Commercial ELISA kits leverage recombinant CP47 for antibody validation .

Comparative Analysis with Other Species

The Nephroselmis olivacea CP47 shares 70–80% sequence identity with homologs in vascular plants and algae:

SpeciesSequence IdentityUnique Features
Spinacia oleracea78%Extended C-terminal domain for PSII-LHCII interaction
Draba nemorosa75%Altered chlorophyll-binding residues
Lactuca sativa76%Enhanced thermostability

Challenges and Future Directions

While recombinant CP47 enables in vitro studies, limitations include:

  • Instability: Requires glycerol or trehalose for long-term storage .

  • Partial Functionality: Lacks post-translational modifications (e.g., phosphorylation) present in chloroplasts .

Future work may focus on engineering full-length, post-translationally modified variants using chloroplast expression systems.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Nephroselmis olivacea (Green alga)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLIAVHLMHTALVSGWAGSMALYEISVFDPSDPVLNPMWRQGM FVIPFMTRLGVTKSWGGWSITGESVSNPGIWSYEGVATAHILLSGALFMAAIWHWVFWDL ELFRDPRTGEPALDLPKIFGIHLFLSGLLCFGFGAFHVTGLYGPGIWVSDPYGITGSVQP VEPAWGPEGFDPFNPGGIASHHIAAGILGILAGLFHLSVRPPQRLYKALRMGNVETVLSS SIAAVFWAAFVVSGTMWYGSAATPIELFGPTRYQWDQGFFQQEIEKRVQGSLASGASLSD AWAKIPEKLSFYDYIGNNPAKGGLFRAGAMNSGDGIAAGWLGHPVFTDKAGNELFVRRMP TFFETFPVLLVDKDGVVRADVPFRRAESKYSIEQVGVSVTFYGGELDGVTFNDPSTVKKY ARRAQLGSVFEFDRATLQSDGVFRSSPRGWFTFGHLWFALLFFFGHIWHGARTIFRDVFG GIDPDLDDQVEFGAFQKLGDVTTRRQAV
Uniprot No.

Target Background

Function

A core component of the Photosystem II (PSII) complex. It binds chlorophyll and facilitates the primary light-driven photochemical reactions of PSII. PSII functions as a light-driven water:plastoquinone oxidoreductase, utilizing light energy to extract electrons from H₂O, generating O₂ and a proton gradient subsequently used for ATP synthesis.

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the psbB gene and what does it encode in Nephroselmis olivacea?

The psbB gene in Nephroselmis olivacea encodes the CP47 chlorophyll apoprotein, which functions as a critical reaction center protein in Photosystem II. This protein constitutes one of the core antenna complexes of PSII and plays an essential role in light harvesting and energy transfer to the reaction center. Within the chloroplast genome, psbB is part of a pentacistronic transcription unit that has been well-characterized in vascular plants, also including psbT, psbH, petB, and petD genes . In Nephroselmis olivacea, this gene is maintained as part of the 127 genes identified in its complete chloroplast DNA sequence (200,799 bp), which represents the largest gene repertoire among green algal and land plant chloroplast DNAs sequenced to date .

How does the CP47 protein function within Photosystem II?

CP47 functions as an integral core antenna protein within Photosystem II, binding approximately 16 chlorophyll molecules. It serves as a crucial interface between the peripheral light-harvesting complexes and the reaction center. The protein's main functions include:

  • Light energy capture through its associated chlorophyll molecules

  • Energy transfer to the PSII reaction center

  • Structural stabilization of the PSII complex

  • Facilitation of proper assembly of the oxygen-evolving complex

The protein contains multiple transmembrane helices that anchor it within the thylakoid membrane, with its chlorophyll-binding domains positioned to optimize energy transfer to the reaction center core . The positioning of CP47 within the PSII complex makes it essential for both the structural integrity and functional efficiency of photosynthetic light reactions.

Why is Nephroselmis olivacea significant for evolutionary studies of photosynthesis?

Nephroselmis olivacea holds particular significance for evolutionary studies of photosynthesis because:

  • It belongs to the Prasinophyceae class, which is thought to include descendants of the earliest-diverging green algae .

  • Its chloroplast genome retains ancestral features that provide insights into the evolution of photosynthetic machinery in green plants.

  • Comparative analysis of its genome with other green algae and land plants reveals evolutionary patterns in photosynthesis-related genes.

  • It contains genes that have unusual distribution patterns across photosynthetic organisms, including some genes found only in non-green algae and others previously only described in land plants .

The presence of genes like ftsI and ftsW in Nephroselmis chloroplast DNA, which are involved in peptidoglycan synthesis, suggests that a peptidoglycan layer or vestige of this layer may be more widespread than previously documented in algal chloroplasts . This provides valuable insights into the evolutionary history of chloroplasts from their cyanobacterial ancestors.

What are the optimal expression systems for producing recombinant Nephroselmis olivacea psbB protein?

For recombinant expression of Nephroselmis olivacea psbB protein, several expression systems can be employed, with E. coli being the most commonly used for initial studies. Based on successful approaches with similar proteins like the Welwitschia mirabilis CP47 protein , the following methodological approach is recommended:

Expression System Selection:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, rapid growth, cost-effectiveMay lack post-translational modifications, risk of inclusion bodiesInitial structural studies, antibody production
ChlamydomonasNative-like folding, proper chlorophyll integrationLower yield, slower growthFunctional studies requiring assembled complexes
Insect cellsBetter membrane protein folding than E. coliHigher cost, more complex protocolsStructural studies requiring proper folding

Optimization Parameters:

  • Use codon-optimized sequences for the selected expression system

  • Employ fusion tags (His, GST, MBP) to improve solubility and facilitate purification

  • Express at lower temperatures (16-20°C) to enhance proper folding

  • Include chlorophyll or chlorophyll precursors in growth media when using photosynthetic hosts

  • Consider membrane-mimicking environments during purification

For most research applications requiring structural characterization, an E. coli expression system with optimization for membrane protein expression is recommended, similar to the approach described for other chloroplast proteins .

What purification protocols yield the highest activity for recombinant psbB protein?

Purification of recombinant psbB protein requires specialized protocols to maintain structural integrity and activity. Based on established methods for similar proteins, the following multi-step approach is recommended:

  • Initial Extraction:

    • For His-tagged constructs, use a buffer containing 20 mM Tris-HCl (pH 8.0), 300 mM NaCl, 5% glycerol, and mild detergent (0.5-1% n-dodecyl-β-D-maltoside)

    • Include protease inhibitors to prevent degradation

  • Affinity Chromatography:

    • Use Ni-NTA resin for His-tagged constructs with stepwise elution (50-250 mM imidazole)

    • Maintain detergent concentration above critical micelle concentration throughout

  • Secondary Purification:

    • Size exclusion chromatography using Superdex 200 column

    • Ion exchange chromatography may be employed as an alternative or additional step

  • Reconstitution Methods:

    • Consider reconstitution into liposomes or nanodiscs for functional studies

    • Buffer optimization is crucial: PBS-based buffer with 6% trehalose at pH 8.0 has shown good results for storage

The purified protein should be stored with 5-50% glycerol at -80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles that can compromise structural integrity . For activity assessment, spectroscopic methods measuring chlorophyll binding and energy transfer capabilities are most appropriate.

How can researchers verify the proper folding and function of recombinant psbB protein?

Verifying proper folding and function of recombinant psbB protein requires multiple complementary approaches:

Structural Verification:

  • Circular Dichroism (CD) spectroscopy to assess secondary structure content

  • Limited proteolysis to confirm compact folding

  • Size exclusion chromatography to verify monodispersity

  • Thermal shift assays to evaluate stability

Functional Assessment:

  • Chlorophyll binding assays (absorption spectra at 400-700 nm)

  • Time-resolved fluorescence to measure energy transfer capabilities

  • Oxygen evolution measurements when incorporated into PSII particles

  • Electron transfer assays using artificial electron acceptors

Integration Testing:

  • Reconstitution with other PSII components

  • Binding assays with known interaction partners

  • In vitro assembly of partial or complete PSII complexes

Each verification method provides complementary information, and researchers should employ multiple approaches to comprehensively characterize their recombinant protein. The absorption spectrum profile should closely match that of native CP47, with characteristic peaks at approximately 440 nm and 670 nm, confirming proper chlorophyll integration.

How can site-directed mutagenesis of psbB inform structure-function relationships in Photosystem II?

Site-directed mutagenesis of the psbB gene provides powerful insights into structure-function relationships within Photosystem II. A systematic approach should target:

Key Residue Categories for Mutagenesis:

Residue TypeFunctionExpected Effect of MutationAnalysis Method
Chlorophyll-bindingLigand coordinationAltered absorption spectra, reduced energy transferSpectroscopy, fluorescence lifetime
Transmembrane helicesStructural stabilityImpaired assembly, altered thermal stabilityThermal shift assays, proteolysis resistance
Interfacial regionsProtein-protein interactionsDisrupted complex formation, altered oxygen evolutionCo-immunoprecipitation, oxygen measurements
Lumenal domainsWater oxidation supportModified calcium/chloride binding, reduced oxygen evolutionOxygen evolution, EPR spectroscopy

When designing a mutagenesis study, researchers should:

  • Create a library of point mutations targeting conserved amino acids identified through sequence alignment of CP47 across species

  • Employ conservative and non-conservative substitutions to distinguish between structural and functional roles

  • Target regions known to interact with other PSII subunits to map interaction surfaces

  • Analyze effects on assembly, stability, and function using complementary biochemical and biophysical methods

Comparison of effects between mutations in Nephroselmis olivacea psbB and those in other species can provide evolutionary insights, as the Prasinophyceae class represents an early divergence in green plant evolution . This evolutionary perspective can highlight which functional domains have been most conserved throughout photosynthetic evolution.

What insights can comparative genomic analysis of psbB across green algae provide?

Comparative genomic analysis of psbB across green algae offers valuable insights into evolutionary patterns and functional constraints. The chloroplast genome of Nephroselmis olivacea represents an important reference point as a member of the early-diverging Prasinophyceae .

Sequence Conservation Analysis:

Examining psbB sequences across the green plant lineage reveals:

  • Highly conserved chlorophyll-binding domains, indicating functional constraints

  • Variable regions that correlate with taxonomic relationships

  • Lineage-specific adaptations in surface-exposed regions

Evolutionary Rate Analysis:

Substitution rate analysis reveals that:

  • psbB generally exhibits lower substitution rates compared to many other chloroplast genes

  • Non-synonymous to synonymous substitution ratios (dN/dS) are typically low, indicating strong purifying selection

  • Parasitic plants show accelerated evolution in photosynthesis genes including psbB

Genomic Context Comparison:

The organization of the psbB operon varies across green algae and land plants:

  • In Nephroselmis and land plants, psbB is part of a pentacistronic transcription unit also containing psbT, psbH, petB, and petD

  • This conserved gene arrangement from Nephroselmis to land plants suggests it was present in the common ancestor of Chlorophyta and Streptophyta

  • The retention of this gene arrangement across evolutionary time indicates potential regulatory or functional constraints

This comparative approach highlights the evolutionary history of the photosynthetic apparatus and identifies functionally critical regions that could be targets for further experimental investigation.

How does post-transcriptional processing of the psbB operon differ between Nephroselmis and other photosynthetic organisms?

Post-transcriptional processing of the psbB operon involves complex RNA metabolism that varies across photosynthetic lineages. The processing pathway in Nephroselmis olivacea can be compared with other organisms to understand evolutionary patterns:

Processing Events in the psbB Operon:

  • Intercistronic Processing:

    • The pentacistronic psbB-psbT-psbH-petB-petD primary transcript undergoes intercistronic cleavage to produce mono-, di-, and multicistronic transcripts

    • The pattern and efficiency of these cleavage events may differ between Nephroselmis and other organisms

  • Intron Splicing:

    • In vascular plants, petB and petD contain group II introns that require splicing

    • Nephroselmis likely employs similar splicing mechanisms, though potentially with lineage-specific factors

  • RNA Stabilization:

    • Differential stability of processed transcripts contributes to stoichiometric accumulation of gene products

    • Protection of RNA termini and secondary structure formation influence transcript half-life

Comparative Analysis of Processing Factors:

Factors involved in post-transcriptional processing may include:

  • Nucleus-encoded RNA-binding proteins

  • Chloroplast-encoded proteins

  • Small RNAs that guide processing events

Research comparing these processes between Nephroselmis and other organisms requires:

  • RNA sequencing to identify and quantify all transcript forms

  • Identification of processing sites through circular RT-PCR or similar techniques

  • Characterization of trans-acting factors through protein-RNA interaction studies

  • Functional studies of processing factors through genetic manipulation

As an early-diverging green alga, Nephroselmis olivacea may retain ancestral processing mechanisms that have been modified in later-diverging lineages, providing insights into the evolution of chloroplast gene expression regulation.

What are the main challenges in isolating functional chloroplasts from Nephroselmis olivacea?

Isolating functional chloroplasts from Nephroselmis olivacea presents several technical challenges due to its unique cellular structure and chloroplast properties. Researchers should consider the following challenges and solutions:

Major Challenges and Recommended Solutions:

ChallengeCauseSolution
Cell wall resistanceRobust cell wall compositionPre-treatment with cell wall-degrading enzymes (cellulase, pectinase) at optimal concentrations
Chloroplast fragilityMembrane sensitivity to osmotic shockUse of isotonic isolation buffers with osmotic stabilizers like sorbitol or sucrose (0.3-0.5 M)
Contamination with nuclear/mitochondrial DNADifficult separation of organellesCsCl-bisbenzimide gradients optimization or alternative approaches like DNase I treatment of lysates
Low yieldSmall cell sizeScale-up of starting material and optimization of breakage conditions

Optimized Isolation Protocol:

As demonstrated in previous work with Nephroselmis, traditional CsCl-bisbenzimide gradients may not effectively resolve nuclear and organelle DNAs . Alternative approaches include:

  • Gentle cell lysis using osmotic shock or mechanical disruption

  • Differential centrifugation series (500g, 1,000g, 5,000g)

  • Purification of chloroplast fractions through discontinuous Percoll gradients

  • Verification of chloroplast integrity through microscopy and oxygen evolution measurements

For subsequent DNA isolation, methods utilizing PCR-amplified fragments complementary to the termini of selected inserts or long PCR-amplified fragments covering gaps between contigs have proven effective for obtaining complete chloroplast genome sequences from Nephroselmis .

How can researchers overcome expression challenges when producing recombinant psbB protein?

Expression of recombinant psbB protein presents significant challenges due to its hydrophobic nature, requirement for cofactors, and complex folding. Based on successful approaches with similar proteins, the following solutions are recommended:

Expression Challenges and Solutions:

  • Protein Toxicity to Host:

    • Employ tightly controlled inducible expression systems

    • Use specialized E. coli strains like C41(DE3) or C43(DE3) designed for toxic membrane proteins

    • Consider cell-free expression systems for highly toxic constructs

  • Inclusion Body Formation:

    • Lower induction temperature to 16-20°C

    • Reduce inducer concentration (0.1-0.5 mM IPTG instead of 1 mM)

    • Co-express molecular chaperones (GroEL/ES, DnaK/J)

    • Fusion with solubility-enhancing tags (MBP, SUMO)

  • Improper Folding:

    • Express as truncated domains if the full-length protein proves recalcitrant

    • Include appropriate detergents in lysis and purification buffers

    • Consider refolding protocols if inclusion bodies are unavoidable

  • Cofactor Integration:

    • Supplement growth media with chlorophyll precursors (δ-aminolevulinic acid)

    • Consider reconstitution with chlorophyll after purification

    • Explore expression in photosynthetic hosts for native cofactor incorporation

A strategic approach similar to that used for Welwitschia mirabilis psbB protein expression has proven successful, with E. coli expression followed by appropriate buffer conditions (Tris/PBS-based buffer with 6% trehalose at pH 8.0) for storage and handling . For reconstitution experiments, gradual detergent removal through dialysis or adsorptive methods can promote proper integration into membrane mimetics.

What analytical methods best characterize the chlorophyll-binding properties of recombinant psbB?

Characterizing the chlorophyll-binding properties of recombinant psbB requires specialized analytical methods that can detect and quantify pigment-protein interactions. The following comprehensive analytical approach is recommended:

Spectroscopic Methods:

  • Absorption Spectroscopy:

    • Record spectra from 350-750 nm to capture chlorophyll Soret and Q bands

    • Compare peak positions and ratios with native protein

    • Analyze chlorophyll a/b ratios if applicable

  • Circular Dichroism (CD):

    • Near-UV and visible region CD (300-700 nm) for pigment environments

    • Far-UV CD (190-250 nm) for protein secondary structure

    • Thermal scanning CD to assess stability of pigment-protein complexes

  • Fluorescence Spectroscopy:

    • Steady-state emission spectra (excitation at 430-440 nm)

    • Excitation spectra (emission at 680 nm)

    • Time-resolved fluorescence for energy transfer dynamics

    • Fluorescence lifetime measurements to assess chlorophyll environment

Biochemical Methods:

  • Pigment Extraction and HPLC Analysis:

    • Quantitative determination of bound chlorophylls

    • Pigment stoichiometry assessment

    • Identification of specific chlorophyll species

  • Binding Assays:

    • Titration with free chlorophyll to determine binding capacity

    • Isothermal titration calorimetry for binding thermodynamics

    • Competition assays with other chlorophyll-binding proteins

Structural Methods:

  • Protein Footprinting:

    • Hydrogen-deuterium exchange mass spectrometry

    • Chemical cross-linking coupled with mass spectrometry

    • Limited proteolysis to identify protected regions

  • Single-Molecule Techniques:

    • Atomic force microscopy for protein-pigment complexes

    • Single-molecule fluorescence resonance energy transfer

For meaningful results, comparison with native CP47 isolated from Nephroselmis or closely related species is essential to validate the recombinant protein's properties. The analysis should focus on both the number of bound chlorophyll molecules and their spatial arrangement, as both factors are critical for proper function within Photosystem II.

How might high-resolution structural studies of Nephroselmis psbB advance our understanding of photosystem evolution?

High-resolution structural studies of Nephroselmis olivacea psbB would provide unprecedented insights into photosystem evolution, particularly as Nephroselmis represents an early diverging lineage of green algae . Such studies would advance our understanding in several dimensions:

Evolutionary Insights from Structural Studies:

  • Ancestral Features Identification:

    • Structural comparison with cyanobacterial counterparts could reveal conserved ancestral features

    • Identification of structural elements that predate the diversification of green plants

    • Recognition of domains that have undergone convergent or divergent evolution

  • Functional Adaptation Mapping:

    • Correlation of structural elements with environmental adaptations

    • Identification of regions under positive selection across lineages

    • Comparison with structural homologs from red algae and other photosynthetic lineages

  • Protein-Cofactor Interaction Evolution:

    • Analysis of chlorophyll-binding pocket architecture compared to other photosynthetic organisms

    • Evolutionary patterns in metal coordination sites

    • Changes in pigment organization that might reflect spectral tuning

Methodological Approaches:

High-resolution structures could be obtained through:

  • X-ray crystallography of isolated protein or PSII subcomplexes

  • Cryo-electron microscopy of reconstituted PSII particles

  • Solid-state NMR studies of membrane-embedded protein

  • Integrative structural biology combining multiple experimental techniques

The structural data would serve as a crucial reference point for understanding the evolution of photosynthetic machinery from early green algae to land plants, potentially revealing transitional features that explain increased photosynthetic efficiency in higher plants.

What potential applications exist for engineered variants of Nephroselmis psbB in artificial photosynthesis?

Engineered variants of Nephroselmis olivacea psbB hold significant potential for artificial photosynthesis applications due to the protein's fundamental role in light harvesting and energy transfer. Strategic engineering approaches could yield variants with enhanced or modified properties:

Engineering Targets and Applications:

Engineering TargetModification ApproachPotential Application
Spectral tuningModification of chlorophyll-binding residuesExpanded light harvesting range for photovoltaics
Stability enhancementIntroduction of disulfide bridges or thermostable motifsBio-solar devices with increased durability
Electron transfer optimizationAlteration of redox-active amino acidsImproved quantum efficiency in biohybrid devices
Interface engineeringSurface modification for attachment to electrodesDirect integration with artificial supports

Research Approaches:

  • Rational Design:

    • Structure-guided mutagenesis targeting specific functional domains

    • Computational prediction of stabilizing mutations

    • Introduction of non-natural amino acids at key positions

  • Directed Evolution:

    • Random mutagenesis combined with high-throughput screening

    • Selection for enhanced stability or altered spectral properties

    • Phage display for identifying variants with desired properties

  • Semi-synthetic Approaches:

    • Integration with synthetic chromophores

    • Coupling with conductive nanomaterials

    • Creation of protein-based photosynthetic circuits

The early evolutionary position of Nephroselmis olivacea makes its psbB particularly valuable for such studies, as it may possess more adaptable features than highly optimized modern counterparts. Additionally, understanding the fundamental differences between the ancestral-type psbB in Nephroselmis and more derived forms could inform the design of minimal functional units for synthetic biology applications.

How can comparative analysis of psbB regulation inform synthetic biology approaches to engineering photosynthesis?

Comparative analysis of psbB regulation across evolutionary lineages provides valuable insights for synthetic biology approaches aimed at engineering photosynthesis. The regulation of psbB in Nephroselmis olivacea, as an early-diverging green alga, offers a glimpse into ancestral regulatory mechanisms:

Regulatory Elements and Their Applications:

  • Transcriptional Regulation:

    • Promoter architecture comparison across green plant lineages

    • Identification of conserved cis-regulatory elements

    • Development of synthetic promoters with predictable expression levels

  • Post-transcriptional Processing:

    • Analysis of RNA processing patterns in the pentacistronic psbB transcription unit

    • Identification of minimal RNA elements required for proper processing

    • Design of synthetic RNA processing modules for coordinated gene expression

  • Translational Control:

    • Comparison of ribosome binding sites and translation efficiency determinants

    • Analysis of codon usage patterns across species

    • Development of optimized translation modules for heterologous expression

Synthetic Biology Applications:

  • Modular Design of Photosynthetic Units:

    • Creation of standardized genetic parts based on conserved regulatory elements

    • Design of tunable expression systems for photosynthetic components

    • Development of genetic circuits that respond to light quality and intensity

  • Transplantable Regulatory Networks:

    • Engineering minimal regulatory networks for heterologous hosts

    • Creation of synthetic operons with coordinated expression of multiple photosynthetic components

    • Implementation of feedback mechanisms based on natural regulatory paradigms

  • Predictive Design Rules:

    • Establishment of design principles for engineering photosynthetic gene expression

    • Development of computational tools for predicting expression outcomes

    • Creation of libraries of characterized regulatory parts with defined behaviors

By understanding the natural regulatory mechanisms governing psbB expression across diverse photosynthetic organisms, synthetic biologists can develop more robust and predictable tools for engineering photosynthesis in both natural and artificial systems. The evolutionary solutions present in Nephroselmis, which has successfully maintained photosynthetic function over long evolutionary timescales, provide valuable blueprints for engineered systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.