Recombinant Nephroselmis olivacea Probable sulfate transport system permease protein cysT (cysT)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Nephroselmis olivacea Probable Sulfate Transport System Permease Protein CysT (cysT) is a heterologously expressed transmembrane protein involved in sulfate ion transport across cellular membranes. This protein, encoded by the cysT gene (UniProt ID: Q9TKU8), is part of the ATP-binding cassette (ABC) transporter family and plays a critical role in sulfur metabolism. Produced in E. coli with an N-terminal His tag, it is widely used in biochemical and functional studies of sulfate transport mechanisms .

Domain Features

  • Contains a conserved sulfate permease domain critical for transmembrane sulfate transport .

  • Structural homology with bacterial CysT proteins, including conserved residues for ATP-binding and ion channel formation .

Functional Role in Sulfate Transport

CysT functions as a permease subunit of the ABC transporter complex, which typically includes:

  1. CysA: ATP-binding subunit.

  2. CysW: Additional transmembrane subunit.

  3. SbpA: Sulfate-binding protein (nuclear-encoded in eukaryotes) .

In Nephroselmis olivacea, CysT is plastid-encoded, unlike in vascular plants where sulfate transporter genes are nuclear . Evolutionary studies highlight its conservation in early-diverging green algae, suggesting ancestral retention of sulfur assimilation pathways .

Recombinant Expression Protocol

StepDescription
Gene CloningFull-length cysT codon-optimized for E. coli expression .
InductionIPTG-induced expression in BL21(DE3) cells.
PurificationImmobilized metal-affinity chromatography (IMAC) via His tag .
ReconstitutionLyophilized protein reconstituted in sterile water (0.1–1.0 mg/mL) .

Stability Considerations

  • Repeated freeze-thaw cycles degrade functionality; aliquots stored at -80°C retain activity for >12 months .

  • Glycerol (5–50%) enhances solubility during long-term storage .

Research Applications

  • Functional Studies: Used to dissect sulfate uptake mechanisms in algal plastids .

  • Comparative Genomics: Serves as a reference for evolutionary analyses of chloroplast-encoded transporters .

  • Biotechnological Engineering: Explored in synthetic biology for sulfur metabolic pathway optimization .

Evolutionary and Ecological Significance

  • Plastid Genome Retention: The cysT gene is retained in Nephroselmis olivacea’s plastome (200,799 bp), which encodes 127 genes—the largest repertoire among green algae .

  • Divergence from Streptophyta: Unlike land plants, Nephroselmis lacks nuclear relocation of sulfate transporter genes, reflecting early evolutionary divergence .

Challenges and Limitations

  • Peptidoglycan Synthesis Link: CysT’s co-occurrence with ftsI (involved in peptidoglycan synthesis) in Nephroselmis suggests unresolved vestigial bacterial pathways .

  • Functional Redundancy: Partial functional overlap with nuclear-encoded transporters complicates in vivo studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We suggest centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cysT; Probable sulfate transport system permease protein cysT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Nephroselmis olivacea (Green alga)
Target Names
cysT
Target Protein Sequence
MFDPKSLDSGSRSILTMKNRLVSWAWALTLMYMLVSLILPIGALLQKSSQESVSEFVSIA TAPVAMSAYAVTLSSALIAALLNGVFGLLIAWVLVRYEFPGRRLLDAAVDLPFALPTSVA GLTLATVYSDQGWIGTWLSSLNIQVAFTRLGVMLAMLFVSFPFVVRTLQPVLQDMERELE EAAWSLGASPFNTFLRVLCPPLMPAMMTGIALAFSRAVGEYGSVVIVSGNIPFQDLIAPV LIFQRLEQYDYSGATVIGTVVLLISLTLLLAINWIQASNRKFLG
Uniprot No.

Target Background

Function
This protein is part of the ABC transporter complex cysAWTP (TC 3.A.1.6.1) involved in sulfate/thiosulfate import. It is likely responsible for the translocation of the substrate across the membrane.
Protein Families
Binding-protein-dependent transport system permease family, CysTW subfamily
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.

Q&A

What is Nephroselmis olivacea and why is its cysT gene significant for evolutionary studies?

Nephroselmis olivacea is a member of the Prasinophyceae class of green algae, thought to include descendants of the earliest-diverging green algae. Its complete chloroplast DNA sequence spans 200,799 base pairs and contains 127 genes, representing the largest gene repertoire among green algal and land plant chloroplast DNAs completely sequenced to date . The presence of the cysT gene in the chloroplast genome of Nephroselmis olivacea is significant because it provides insights into the evolutionary history of sulfate transport mechanisms in photosynthetic organisms. The conservation of this gene between Nephroselmis and other green algae like Chlorella suggests it represents an ancestral feature that may have been derived from the genome of the cyanobacterial progenitor of chloroplasts .

What is the predicted function of the CysT protein in Nephroselmis olivacea?

Based on homology with bacterial systems, the CysT protein in Nephroselmis olivacea likely functions as a membrane component of an ABC-type transporter system involved in sulfate and thiosulfate transport. In Escherichia coli, CysT works together with CysW and CysA as membrane components of a sulfate/thiosulfate transport system, while CysP and Sbp function as periplasmic binding proteins that capture these ions . The Nephroselmis olivacea CysT protein likely performs a similar function in facilitating sulfate uptake across membranes, which is essential for sulfur assimilation and subsequent biosynthesis of sulfur-containing molecules.

Where is the cysT gene located in the Nephroselmis olivacea genome?

The cysT gene is located in the chloroplast genome of Nephroselmis olivacea. Specifically, it is part of a gene cluster "rpl32-cysT-ycf1" that is shared between Nephroselmis and Chlorella chloroplast DNAs . This genomic arrangement differs from that observed in land plant chloroplast DNAs, indicating evolutionary divergence after the split between chlorophytes and streptophytes. The presence of cysT in the chloroplast genome rather than the nuclear genome suggests its importance for local regulation or assembly of the protein directly in the chloroplast.

What expression systems are most suitable for recombinant production of Nephroselmis olivacea CysT?

For the recombinant production of membrane proteins like CysT, several expression systems should be considered:

  • E. coli-based expression systems: These can be optimized for membrane protein expression using specialized strains (C41/C43, Lemo21) and vectors with tightly regulated promoters.

  • Yeast expression systems: Pichia pastoris or Saccharomyces cerevisiae provide eukaryotic processing capabilities that may benefit proper folding of algal proteins.

  • Cell-free expression systems: These bypass toxicity issues often encountered when overexpressing membrane proteins in living cells.

  • Algal expression systems: Chlamydomonas reinhardtii could provide a more native environment for proper folding and post-translational modifications.

The selection should be based on research objectives - structural studies may prioritize high yield, while functional studies may require native-like lipid environments.

What cloning strategies should be employed for optimal expression of recombinant Nephroselmis olivacea CysT?

Successful cloning and expression of CysT would benefit from:

  • Codon optimization: Adapting the Nephroselmis olivacea cysT gene sequence to the codon preference of the chosen expression host.

  • Fusion tags selection: N-terminal fusions with solubility-enhancing tags (MBP, SUMO) may improve expression, while affinity tags (His, Strep) facilitate purification.

  • Signal sequence consideration: Including or replacing native signal sequences to ensure proper membrane targeting.

  • Vector features: Selection of vectors with elements like temperature-inducible promoters that allow tight control over expression timing and level.

  • Seamless cloning techniques: Methods such as Gibson Assembly that allow precise fusion without introducing unwanted sequences.

For optimal results, several constructs with different tag combinations and positions should be tested in parallel.

What purification approaches are most effective for membrane proteins like CysT?

Purifying membrane proteins requires specialized approaches:

  • Membrane isolation: Differential centrifugation to isolate membrane fractions containing the recombinant protein.

  • Detergent screening: Systematic testing of various detergents (DDM, LDAO, etc.) to identify those that effectively extract CysT while preserving native conformation.

  • Chromatographic techniques:

    • Immobilized metal affinity chromatography (IMAC) for initial capture

    • Size exclusion chromatography for further purification and detergent exchange

    • Ion exchange chromatography to remove contaminants with different charge properties

  • Protein stabilization: Addition of lipids or cholesterol during purification to maintain protein stability.

  • Quality assessment: Techniques like circular dichroism, fluorescence spectroscopy, and gel filtration profiles to verify proper folding.

How can researchers assess the transport function of recombinant Nephroselmis olivacea CysT?

Functional assessment of CysT can be approached through several complementary methods:

  • Complementation assays: Testing whether Nephroselmis olivacea cysT can rescue E. coli cysT mutants, which would demonstrate functional conservation .

  • Transport assays:

    • Radioactive sulfate (35S) uptake studies in proteoliposomes reconstituted with purified CysT

    • Fluorescent sulfate analogs for real-time monitoring of transport

    • Ion-selective electrodes to measure sulfate flux

  • Binding assays: Isothermal titration calorimetry or microscale thermophoresis to characterize sulfate binding.

  • Patch-clamp electrophysiology: If CysT forms or contributes to an ion channel, electrophysiological measurements can characterize its properties.

  • ATPase activity assays: If working with the complete ABC transporter complex, measuring ATP hydrolysis rates in response to substrate.

These approaches would provide complementary data on transport kinetics, substrate specificity, and energy coupling.

What techniques can be used to study protein-protein interactions involving Nephroselmis olivacea CysT?

As CysT likely functions as part of a multi-protein complex, several techniques can reveal its interaction partners:

  • Co-immunoprecipitation: Using antibodies against CysT or epitope tags to pull down interacting proteins.

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry to identify proteins in close proximity to CysT.

  • Two-hybrid systems: Modified membrane-based two-hybrid approaches suitable for membrane proteins.

  • FRET/BRET: Fluorescence or bioluminescence resonance energy transfer between CysT and potential partners tagged with appropriate fluorophores.

  • Co-purification studies: Tandem affinity purification followed by mass spectrometry to identify stable interaction partners.

  • Native gel electrophoresis: Blue native PAGE to isolate intact membrane protein complexes containing CysT.

These approaches would help elucidate whether Nephroselmis CysT interacts with proteins analogous to the CysW, CysA, CysP, and Sbp components identified in the E. coli sulfate transport system .

How can subcellular localization of CysT be determined in Nephroselmis olivacea?

Confirming the subcellular localization of CysT requires specialized techniques for membrane proteins:

  • Immunolocalization: Generation of specific antibodies against CysT for immunofluorescence microscopy or immunogold electron microscopy.

  • Fluorescent protein fusions: Creating CysT-GFP fusions for live-cell imaging, ensuring the tag doesn't disrupt targeting signals.

  • Cell fractionation: Biochemical separation of cellular compartments followed by Western blotting to detect CysT in specific fractions.

  • Protease protection assays: To determine the topology of CysT within the membrane.

  • Organelle isolation: Purification of intact chloroplasts followed by subfractionation to confirm localization to specific chloroplast membranes.

These approaches would confirm whether CysT is indeed localized to chloroplast membranes as predicted based on its presence in the chloroplast genome.

What strategies can be employed to determine the structure of Nephroselmis olivacea CysT?

Structural determination of membrane proteins like CysT presents unique challenges requiring specialized approaches:

  • X-ray crystallography: Requires identification of optimal detergents and crystallization conditions, potentially using lipidic cubic phase methods specifically designed for membrane proteins.

  • Cryo-electron microscopy: Single-particle analysis for high-resolution structure determination, particularly effective for larger complexes containing CysT.

  • Nuclear magnetic resonance (NMR): Solution NMR for studying dynamic aspects of CysT structure, though challenging for larger membrane proteins.

  • Hydrogen-deuterium exchange mass spectrometry: To probe solvent-accessible regions and conformational changes.

  • Computational modeling:

    • Homology modeling based on related bacterial transporters

    • Ab initio modeling in combination with sparse experimental constraints

    • Molecular dynamics simulations to explore conformational flexibility

For membrane proteins, a combination of these approaches often yields the most comprehensive structural insights.

How can targeted mutagenesis be used to study structure-function relationships in CysT?

Systematic mutagenesis approaches can reveal critical residues for CysT function:

  • Alanine-scanning mutagenesis: Systematically replacing residues in predicted transmembrane regions with alanine to identify functionally important amino acids.

  • Cysteine-scanning mutagenesis: Introducing cysteines for subsequent labeling with sulfhydryl reagents to probe accessibility and proximity relationships.

  • Conservation-guided mutagenesis: Targeting highly conserved residues identified through multiple sequence alignments of CysT homologs.

  • Domain swapping: Exchanging segments between CysT homologs from different species to identify regions responsible for specific functional properties.

Following mutagenesis, functional assays measuring transport activity, substrate binding, or protein-protein interactions would reveal the impact of each mutation, mapping functional regions within the protein.

What computational approaches can predict structural features of Nephroselmis olivacea CysT?

In the absence of experimental structures, computational methods offer valuable structural insights:

  • Transmembrane topology prediction: Algorithms like TMHMM, TOPCONS, or MEMSAT can predict membrane-spanning regions.

  • Homology modeling: Using known structures of related bacterial ABC transporters as templates.

  • Co-evolution analysis: Methods like Direct Coupling Analysis (DCA) to predict residue contacts based on evolutionary constraints.

  • Molecular dynamics simulations: To model CysT behavior in membrane environments and predict conformational changes during transport.

  • Ligand docking: Computational docking of sulfate or thiosulfate to predict substrate binding sites.

These computational predictions generate testable hypotheses about structure-function relationships that can guide experimental design.

What does comparative genomics reveal about the evolution of cysT in green algae?

Comparative genomic analysis provides several insights into cysT evolution:

  • Conservation patterns: The cysT gene is present in both Nephroselmis olivacea and Chlorella, suggesting conservation across certain green algal lineages .

  • Gene clustering: The gene cluster "rpl32-cysT-ycf1" is shared specifically between Nephroselmis and Chlorella , indicating conservation of this genomic arrangement since their last common ancestor.

  • Evolutionary history: The presence of cysT in the chloroplast genome suggests it was likely inherited from the cyanobacterial progenitor of chloroplasts and retained during endosymbiotic evolution.

  • Selective pressures: Conservation of cysT suggests functional importance, as genes without essential functions tend to be lost from the compact chloroplast genome over evolutionary time.

This pattern suggests that sulfate transport via CysT represents an ancestral function that has been maintained in certain green algal lineages but potentially lost or transferred to the nuclear genome in others.

What is the significance of finding bacterial-type genes like cysT in the chloroplast genome?

The presence of bacterial-type genes like cysT in the chloroplast genome has several important implications:

  • Endosymbiotic origin: It provides direct evidence for the endosymbiotic origin of chloroplasts from cyanobacteria, as these genes represent remnants of the original bacterial genome.

  • Selective retention: The retention of cysT in the chloroplast genome suggests functional importance, possibly related to advantages of local gene expression for membrane proteins functioning in the chloroplast.

  • Evolutionary insights: Together with other genes like ftsI (involved in peptidoglycan synthesis), the presence of cysT suggests that certain bacterial metabolic pathways or structural features may be more widespread in algal chloroplasts than previously documented .

  • Ancient features: The quadripartite structure and gene-partitioning pattern shared between Nephroselmis and land plant chloroplast DNAs, along with gene content similarities, represent ancient features likely derived from the genome of the cyanobacterial progenitor .

How does the gene organization around cysT compare between Nephroselmis olivacea and other photosynthetic organisms?

The genomic context of cysT varies across species in informative ways:

OrganismGene OrganizationReference
Nephroselmis olivacearpl32-cysT-ycf1
Chlorellarpl32-cysT-ycf1
Land plantsDifferent organization (cysT not identified)
CyanophoraDifferent organization

This comparative analysis reveals:

How does CysT-mediated sulfate transport integrate with sulfur metabolism in algae?

CysT-mediated sulfate transport likely serves as a critical entry point for sulfur into algal metabolism:

Understanding these connections requires integrating transport studies with metabolomic analyses of sulfur-containing compounds under various nutrient conditions.

How might the CysT transport system differ functionally between bacterial and algal systems?

The evolutionary transition from bacterial to algal chloroplast environments likely required functional adaptations of the CysT transport system:

  • Membrane environment adaptations:

    • Different lipid composition between bacterial and chloroplast membranes

    • Possible adaptations in transmembrane domains for optimal function

  • Regulatory differences:

    • Bacterial systems respond to environmental sulfate availability

    • Chloroplast systems must coordinate with host cell metabolism and nucleus-encoded components

  • Energetic considerations:

    • Bacterial ABC transporters use ATP directly

    • Chloroplast transporters may have adapted to utilize the unique energetic environment of the chloroplast

  • Integration with organellar functions:

    • Coordination with photosynthesis and carbon fixation

    • Potential roles in maintaining redox balance within the chloroplast

Comparative biochemical studies between bacterial and algal CysT proteins, including kinetic parameters, substrate specificity, and regulatory mechanisms, would highlight these evolutionary adaptations.

How can genome editing tools be applied to study CysT function in Nephroselmis olivacea or related algae?

While specific transformation protocols for Nephroselmis olivacea may not be established, several genome editing approaches could be adapted:

  • CRISPR/Cas9 strategies:

    • Targeted knockout of cysT to assess phenotypic consequences

    • Introduction of point mutations to study structure-function relationships

    • Tagging with reporter genes for localization and expression studies

  • Transplastomic approaches:

    • Chloroplast transformation to introduce modified versions of cysT

    • Homologous recombination for precise gene replacement

    • Biolistic delivery of DNA constructs targeting the chloroplast genome

  • RNAi or antisense approaches:

    • Knockdown of cysT expression if complete knockout is lethal

    • Temporary reduction of expression to study physiological effects

  • Heterologous complementation:

    • Expression of Nephroselmis cysT in model algae with disrupted sulfate transport

    • Assessment of functional conservation across species

Implementation would require adaptation of protocols developed for model algal systems like Chlamydomonas reinhardtii, potentially using methods similar to those described for RNA extraction and quantitative PCR in the search results .

What systems biology approaches would provide insights into the role of CysT in algal metabolism?

Systems biology offers powerful tools to understand CysT's place in the broader metabolic network:

  • Multi-omics integration:

    • Combining transcriptomics, proteomics, and metabolomics data under varying sulfur conditions

    • Correlation analysis to identify pathways responding to changes in CysT expression

  • Flux balance analysis:

    • Mathematical modeling of sulfur metabolism with varying constraints on sulfate transport

    • Prediction of growth phenotypes under different conditions

  • Network analysis:

    • Construction of gene regulatory networks controlling sulfur metabolism

    • Identification of master regulators coordinating sulfate transport with assimilation

  • Comparative systems analysis:

    • Evolutionary comparisons of sulfur metabolic networks across algal lineages

    • Identification of conserved and divergent regulatory mechanisms

  • Environmental response modeling:

    • Predicting how the sulfate transport system responds to changing environmental conditions

    • Understanding adaptation to sulfur limitation in natural habitats

These approaches would place CysT function in the context of whole-cell metabolism and ecological adaptation.

How might research on algal sulfate transporters contribute to biotechnological applications?

Understanding and manipulating algal sulfate transport systems offers several biotechnological opportunities:

  • Improved biomass production:

    • Engineering more efficient sulfate uptake for enhanced growth under limiting conditions

    • Optimizing sulfur utilization efficiency in algal biofuel production

  • Bioaccumulation applications:

    • Engineering algae for enhanced uptake of sulfate or toxic sulfur compounds for bioremediation

    • Development of biosensors for environmental sulfate monitoring

  • Sulfur-rich compound production:

    • Enhanced production of valuable sulfur-containing molecules (e.g., sulfolipids, bioactive compounds)

    • Metabolic engineering to direct sulfur flux toward specific products

  • Stress tolerance improvement:

    • Enhancing sulfate uptake to support increased glutathione production for improved oxidative stress tolerance

    • Development of algal strains with enhanced performance in high-salinity environments

  • Fundamental insight into transport mechanisms:

    • Discovery of novel features of ABC transporters that could inform design of drug delivery systems

    • Structural insights that could benefit understanding of human ABC transporters involved in disease

What are the most significant unanswered questions regarding Nephroselmis olivacea CysT?

Despite the insights gained from genomic analysis, several fundamental questions remain unanswered:

  • Structural characteristics:

    • What is the three-dimensional structure of CysT?

    • How does its structure compare to bacterial homologs?

    • What residues are critical for substrate recognition and transport?

  • Transport mechanism:

    • What is the precise stoichiometry of sulfate transport?

    • How is transport energetically coupled?

    • What is the substrate specificity (sulfate vs. thiosulfate vs. other anions)?

  • Protein interactions:

    • Does Nephroselmis CysT function with partners analogous to the CysW and CysA proteins of bacterial systems?

    • Are these partner proteins encoded in the chloroplast or nuclear genome?

  • Regulatory mechanisms:

    • How is cysT expression regulated in response to sulfur availability?

    • What post-translational modifications might regulate CysT activity?

  • Evolutionary significance:

    • Why has cysT been retained in the chloroplast genome rather than transferred to the nucleus?

    • What selective pressures maintain this gene arrangement across certain algal lineages?

What technological advances would facilitate research on algal membrane transporters like CysT?

Progress in several areas would accelerate research on algal membrane transporters:

  • Expression and purification technologies:

    • Development of algal-optimized cell-free expression systems

    • Novel detergents or nanodiscs better suited to algal membrane proteins

    • High-throughput purification platforms for membrane proteins

  • Structural biology advances:

    • Improved cryo-EM techniques for smaller membrane proteins

    • Development of X-ray free electron laser methods for microcrystals

    • Advanced computational methods for membrane protein structure prediction

  • Genetic tool development:

    • Expanded genome editing capabilities for non-model algal species

    • Chloroplast-specific expression systems with regulated promoters

    • Inducible gene expression systems for toxic membrane proteins

  • Imaging technologies:

    • Super-resolution microscopy methods optimized for algal cells

    • Single-molecule tracking techniques to follow transport events in real-time

    • Improved fluorescent probes for sulfate visualization

  • System-level measurement techniques:

    • Single-cell metabolomics for heterogeneity analysis

    • Real-time monitoring of intracellular sulfate concentrations

    • Non-invasive methods to measure transport in living cells

These technological advances would address current bottlenecks in algal membrane protein research.

How does understanding CysT contribute to our broader knowledge of chloroplast evolution?

The study of CysT provides valuable insights into chloroplast evolution:

  • Endosymbiotic gene retention patterns:

    • CysT represents a case study of a gene retained in the chloroplast genome

    • Understanding why certain genes resist transfer to the nucleus informs endosymbiotic theory

  • Evolutionary conservation of transport functions:

    • Comparison between bacterial and algal sulfate transport systems reveals adaptations during chloroplast evolution

    • Insights into the integration of ancestral cyanobacterial systems into eukaryotic cell metabolism

  • Genomic architecture conservation:

    • The retention of quadripartite structure and similar gene sets in corresponding genomic regions between Nephroselmis and land plants suggests ancient features derived from the cyanobacterial progenitor

    • The gene clustering patterns inform understanding of chloroplast genome evolution

  • Functional adaptation during organelle evolution:

    • Changes in transport specificity or regulation reflect adaptation to the intercellular environment

    • Insights into how endosymbiotic organelles maintained metabolic integration with host cells

  • Comparative insights across lineages:

    • The presence of genes like cysT in some lineages but not others reveals differential evolutionary trajectories

    • Understanding these patterns helps reconstruct the genomic content of ancestral chloroplasts

These evolutionary insights extend beyond CysT itself to inform our broader understanding of organelle evolution and the endosymbiotic origin of chloroplasts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.