Recombinant Nephroselmis olivacea Uncharacterized tatC-like protein ymf16 (YMF16)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we can accommodate your specific requirements. Please indicate your preferred format in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer components, storage temperature, and the stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development for your order.
Synonyms
YMF16; Uncharacterized tatC-like protein ymf16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Nephroselmis olivacea (Green alga)
Target Names
YMF16
Target Protein Sequence
MNFVISQHFNEIKYRFLYIFFTFLLCFIICTIYSESIMFFYVHPLINLTSMQGKHLIFTE MSEAFHTYIFLCFFTSIYCTFPYFFYQFWAFFIPSTYQFERLQLRFLSFFFFTLLFFSCI IIYFIILPEIWSFFLHFEKKSYYFNLQLEARISSYIQFTFQIFSYFFVLFQCPLFTHFSL NLNLLTISFLVNSRKYIYFLFLILAAFLSPPDILSQFFLFSLIVFMYELCVFYSCFYDSL RERIKTF
Uniprot No.

Target Background

Protein Families
TatC family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is tatC/ymf16 and where is it found?

The tatC-like protein ymf16 is a subunit of the twin-arginine translocation (Tat) pathway, which facilitates the transport of folded proteins across biological membranes. In cryptophyte algae, tatC (ymf16) is encoded in the mitochondrial genome and serves as an essential component of the protein transport machinery . This protein is part of a core set of genes conserved across cryptophyte mitochondrial genomes, alongside rRNAs, tRNAs, and other protein-coding genes involved in respiration and ATP synthesis. The presence of mitochondrion-encoded tatA and tatC genes in cryptophytes is particularly notable, as these were previously thought to be exclusive to primitive mitochondrial genomes like those in jakobids and malawimonads .

How conserved is tatC/ymf16 across different algal species?

The tatC/ymf16 gene shows remarkable conservation across diverse algal lineages. Comparative genomic analyses reveal that this gene is present in the mitochondrial genomes of multiple cryptophyte species including Chroomonas placoidea, Hemiselmis andersenii, Proteomonas sulcata, Cryptomonas curvata, Storeatula sp. CCMP1868, Teleaulax amphioxeia, and Rhodomonas salina . This conservation suggests functional importance in mitochondrial protein transport systems. The gene is also found in other algal species like Nephroselmis olivacea , indicating its widespread distribution across evolutionary distant algal lineages.

What is the functional role of tatC in the Tat protein translocase system?

The Tat protein translocase system is responsible for transporting fully folded proteins across membranes, a task that distinguishes it from other protein translocation systems. In this complex, tatC serves as a central organizing component that recognizes substrate proteins and coordinates their translocation . Research on bacterial Tat systems indicates that tatC interacts with both tatA and tatB proteins to form a functional translocation complex. TatC contains multiple transmembrane helices that create binding sites for other Tat components and substrate proteins. Importantly, tatC participates in recognizing the twin-arginine motif in signal peptides of substrate proteins, making it crucial for substrate selectivity and transport initiation .

What domains and motifs are functionally important in tatC/ymf16?

Several key structural elements in tatC are critical for its function:

  • Transmembrane helices (TM1-TM6): These form specific interaction surfaces with tatA and tatB proteins. Particularly, TM5 and TM6 create an important binding site for both tatA and tatB .

  • Intramembrane polar clusters: Unusual polar amino acid residues within the membrane-spanning regions form hydrogen bonds with partner proteins. These are essential for complex assembly and function .

  • Periplasmic cap loops: These flexible regions between transmembrane helices help stabilize the tatBC complex and may accommodate structural changes during protein transport .

The presence of these functional domains is supported by both evolutionary co-variation analysis and experimental validation through site-directed mutagenesis studies.

How does tatC interact with other components of the Tat pathway?

TatC interactions with other Tat components follow a sophisticated pattern revealed through co-evolutionary and experimental analyses. Key interaction features include:

  • TatB-TatC interface: Each tatB transmembrane helix (TMH) is sandwiched between two different tatC molecules, with extensive contacts between the tatB TMH and a site formed by TM5 and TM6 of one tatC molecule. The opposite face of tatB TMH forms a more limited interaction with TM1 of a second tatC molecule .

  • Polar cluster formation: Intramembrane hydrogen-bonding interactions occur between polar residues in the tatB TMH and two polar residues on tatC. This polar cluster is essential for Tat function .

  • TatA-TatC interface: Unexpectedly, tatA interacts with the same TM5/TM6 site on tatC that is used to bind tatB. This dual-use binding site suggests a mechanism for controlled assembly of the translocase .

  • TatC-TatC interactions: Adjacent tatC molecules interlock through specific residue pairs in periplasmic cap loops, contributing to the formation of a hollow dome-shaped structure .

The resulting complex creates a specialized environment that may facilitate the translocation of folded proteins across the membrane.

What expression systems are optimal for recombinant production of tatC/ymf16?

Expressing membrane proteins like tatC presents significant challenges due to their hydrophobic nature and complex folding requirements. Based on established methodologies for similar proteins, the following expression systems may be optimal:

Table 1: Comparison of Expression Systems for Recombinant tatC/ymf16

Expression SystemAdvantagesLimitationsSpecial Considerations
E. coli- High yield
- Well-established protocols
- Low cost
- Potential improper folding
- Inclusion body formation
- Use C41(DE3) or C43(DE3) strains specialized for membrane proteins
- Lower induction temperature (16-25°C)
Yeast (P. pastoris)- Eukaryotic processing
- High-density cultures
- Proper folding
- Longer expression time
- More complex media
- Methanol induction optimization
- Codon optimization for algal genes
Insect cells- Advanced folding machinery
- Post-translational modifications
- Higher cost
- Technical complexity
- Baculovirus optimization
- Careful detergent selection for extraction
Cell-free systems- Rapid expression
- Direct incorporation into liposomes
- Lower yields
- Higher cost
- Supplementation with lipids/detergents
- Temperature optimization

For tatC/ymf16 from Nephroselmis olivacea, a combination approach may be beneficial: initial screening in E. coli followed by optimization in eukaryotic systems for functional studies.

What purification strategies yield functional recombinant tatC/ymf16?

Purifying membrane proteins like tatC requires specialized approaches to maintain structural integrity and function:

  • Membrane isolation: After expression, carefully isolate membrane fractions using differential centrifugation techniques. This separates membrane-integrated tatC from cytosolic proteins.

  • Detergent selection: Screen multiple detergents for optimal solubilization. Milder detergents (DDM, LMNG, or digitonin) typically preserve protein structure better than harsh detergents like SDS.

  • Affinity chromatography: Utilize affinity tags (His6, FLAG, or Strep-tag II) positioned at termini least likely to interfere with function. For tatC, C-terminal tags are often preferable as the N-terminus may be involved in protein-protein interactions.

  • Size exclusion chromatography: This critical step separates monomeric tatC from aggregates and other contaminants while assessing protein quality through elution profiles.

  • Reconstitution: For functional studies, reconstitute purified tatC into proteoliposomes or nanodiscs to restore a membrane-like environment.

Throughout purification, maintain strict temperature control (typically 4°C) and include protease inhibitors to prevent degradation of the recombinant protein.

How can the functionality of recombinant tatC/ymf16 be assessed?

Verifying that recombinant tatC/ymf16 is properly folded and functional is essential before proceeding with advanced studies. Several complementary approaches can be employed:

  • Substrate binding assays: Assess the ability of purified tatC to bind Tat signal peptides using techniques such as microscale thermophoresis (MST) or surface plasmon resonance (SPR).

  • Complex formation analysis: Test whether recombinant tatC can assemble with tatA and tatB components using techniques like blue native PAGE or co-immunoprecipitation.

  • Reconstituted system transport assays: Develop in vitro transport assays using proteoliposomes containing reconstituted Tat components and fluorescently labeled substrate proteins.

  • Structural integrity assessment: Employ circular dichroism (CD) spectroscopy to verify secondary structure content consistent with properly folded tatC.

  • Cross-complementation studies: Express recombinant Nephroselmis olivacea tatC in tatC-deficient bacterial or algal strains to test whether it can restore Tat transport function.

How can recombinant tatC/ymf16 be used to study evolutionary aspects of protein transport systems?

The presence of tatC/ymf16 in algal mitochondrial genomes offers unique opportunities to study the evolution of protein transport systems:

  • Comparative genomic analysis: The mitochondrial location of tatC in cryptophytes and other algae contrasts with its nuclear encoding in most eukaryotes. Researchers can use tatC sequence data to trace evolutionary relationships between different algal lineages .

  • Ancestral state reconstruction: By analyzing tatC sequences across diverse taxa, researchers can infer ancestral forms of this protein and track evolutionary changes in the Tat system.

  • Endosymbiotic gene transfer studies: The presence of tatC in mitochondrial genomes of some algae but not others provides a system to study the process of gene transfer from organelles to the nucleus during evolution .

  • Functional conservation testing: Recombinant tatC from different evolutionary lineages can be tested in heterologous systems to determine the degree of functional conservation across large evolutionary distances.

The unique genomic arrangement of tatC and other transport-related genes in cryptophyte mitochondria provides an exceptional model for understanding how protein transport systems evolved after endosymbiosis.

What insights can be gained by studying interactions between tatC/ymf16 and other Tat components?

Detailed analysis of tatC interactions with other Tat components can reveal fundamental principles of membrane protein translocase systems:

  • Binding site competition: Research shows that tatA and tatB bind to the same site on tatC (TM5/TM6), suggesting a competitive binding mechanism that may regulate translocase assembly . Further studies with recombinant components could elucidate how this competition is regulated.

  • Transport energetics: By reconstituting tatC with tatA, tatB, and substrate proteins in proteoliposomes, researchers can investigate how proton motive force is coupled to protein transport.

  • Assembly dynamics: Real-time studies of complex formation using techniques like fluorescence resonance energy transfer (FRET) with labeled tatC and partner proteins can reveal the kinetics and sequence of assembly events.

  • Substrate recognition: Systematic analysis of tatC interactions with different signal peptides can illuminate the molecular basis of substrate selectivity in the Tat pathway.

These studies could substantially advance our understanding of membrane protein transport mechanisms beyond the specific case of algal tatC.

How do mutations in tatC/ymf16 affect protein transport efficiency?

Systematic mutagenesis of tatC can provide crucial insights into structure-function relationships:

  • Critical residue identification: Mutations in the intramembrane polar cluster of tatC significantly impair Tat function, demonstrating the essential nature of these residues for complex assembly and function .

  • Binding interface mapping: By creating a panel of tatC mutants and assessing their ability to interact with tatA and tatB, researchers can precisely map binding interfaces beyond what has been determined by co-evolutionary analysis.

  • Transport kinetics analysis: Mutations that don't abolish function but alter transport efficiency can reveal rate-limiting steps in the translocation process.

  • Substrate specificity alterations: Some tatC mutations may selectively affect transport of certain substrates but not others, providing insights into substrate recognition mechanisms.

Through such mutational analyses, researchers can develop a comprehensive functional map of tatC that connects specific structural features to discrete steps in the transport process.

How does Nephroselmis olivacea tatC/ymf16 compare to homologs in other algae?

The tatC protein from Nephroselmis olivacea represents just one variant in a diverse family of homologs across algal species. Comparative analysis reveals:

  • Sequence conservation patterns: While core functional regions show high conservation, peripheral regions display greater variability across species. This pattern helps identify functionally critical domains.

  • Genomic context differences: In cryptophytes, tatC and tatA genes are located in the mitochondrial genome, while in other algal lineages, they may be nuclear-encoded with organelle-targeting sequences .

  • Co-evolution with partner proteins: The evolution of tatC appears coupled to changes in tatA and tatB, reflecting their physical interactions. Analyzing these co-evolutionary patterns across algal species can provide insights into interaction networks.

The uncharacterized nature of Nephroselmis olivacea tatC presents research opportunities to determine whether functional differences exist between this and better-characterized homologs from model organisms.

What are the implications of tatC/ymf16 gene arrangements in different algal mitochondrial genomes?

The organization of tatC and related genes in mitochondrial genomes varies significantly across algal species:

  • Strand distribution: In some cryptophytes (Chroomonas placoidea, Hemiselmis andersenii, Proteomonas sulcata), all genes are located on the same strand of the mitochondrial genome, while in others (Cryptomonas curvata, Storeatula sp. CCMP1868, Teleaulax amphioxeia, Rhodomonas salina), tatC and other genes are distributed between both strands .

  • Synteny and rearrangements: Comparative genomic analyses have identified multiple gene-order rearrangements involving tatC and surrounding genes across cryptophyte species. These rearrangements involve transpositions, inversions, and combinations of both mechanisms .

  • Evolutionary implications: The pattern of gene rearrangements provides insights into the evolutionary history of these algal lineages and the forces shaping mitochondrial genome architecture.

Table 2: Mitochondrial Genome Features and tatC Gene Arrangements in Selected Algal Species

SpeciesGenome Size (kb)tatC Strand LocationNotable RearrangementsReference
Chroomonas placoidea~48Single strandBaseline for comparison
Hemiselmis andersenii~60Single strandSimilar arrangement to C. placoidea
Proteomonas sulcata~48Single strandSimilar arrangement to C. placoidea
Teleaulax amphioxeia~50Multi-strand (39 genes)Transposition of synteny block C; Inversion of blocks G-L
Rhodomonas salina~58Multi-strand (53 genes)Transposition of nad3 and rps2; Transposition of block D-E; Inversion of blocks G-J
Storeatula sp. CCMP1868VariableMulti-strand (41 genes)Multiple rearrangements compared to other cryptophytes

These genomic arrangement differences provide natural experiments to study how gene position and orientation influence expression and function of tatC and other mitochondrial genes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.