Recombinant Neurospora crassa 3-ketoacyl-CoA reductase (NCU11297)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us for preferential development.
Synonyms
NCU11297; Very-long-chain 3-oxoacyl-CoA reductase; 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR; Microsomal beta-keto-reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
NCU11297
Target Protein Sequence
MDKVAEIWGTVPQYGQWALAGIGALYVATRVGAFLQLLLNAFILSGTNLRKYGKKGTWAV ITGASDGLGKEFAQQLASKGFNLVLVSRTQSKLDVLARELELRWDGFKAKTFAMDFSKDD DSDYERLAELIKGLDIGILINNVGQSHSIPVPFLQTDRDELQNIVTINCLGTLKTTKVVA PILAQRKKGLILTMGSFAGVMPTPYLATYSGSKAFLQHWSSALSAELKDQGVDVHLVVSY LVTTAMSKIRRTSLLIPNPKQFVRAALGKVGLNSSEPFPNTYTPWWSHAVFKWVVENTVG AYSYFTLRLNKNMHIDIRNRALRKAAREAKKQ
Uniprot No.

Target Background

Function

Recombinant Neurospora crassa 3-ketoacyl-CoA reductase (NCU11297) is a component of the microsomal membrane-bound fatty acid elongation system. It produces very-long-chain fatty acids (VLCFAs), specifically 26-carbon VLCFAs, from palmitate. This enzyme catalyzes the reduction of the 3-ketoacyl-CoA intermediate in each cycle of fatty acid elongation. These VLCFAs serve as precursors for ceramide and sphingolipids.

Database Links

KEGG: ncr:NCU04462

Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

  • What is the function of 3-ketoacyl-CoA reductase (NCU11297) in Neurospora crassa?

    3-ketoacyl-CoA reductase (KCR) in Neurospora crassa is essential in fatty acid elongation, specifically catalyzing the reduction of 3-ketoacyl-CoA to 3-hydroxyacyl-CoA using NADPH as a cofactor. This represents the second step in the fatty acid elongation cycle. In the elongation pathway, malonyl coenzyme A and long-chain acyl-coenzyme A are first condensed by ketoacyl-CoA synthase (KCS), then reduced by KCR to produce 3-hydroxyacyl coenzyme A. This product is subsequently dehydrated by hydroxyacyl-CoA dehydratase (HCD) to produce 2-enoyl coenzyme A, which is finally reduced to long-chain acyl-coenzyme A by enoyl-CoA reductase (ECR) . NCU11297 is also known as microsomal beta-keto-reductase and plays a crucial role in lipid metabolism pathways .

  • How is 3-ketoacyl-CoA reductase expression regulated in Neurospora crassa?

    Like other enzymes involved in lipid metabolism in Neurospora crassa, 3-ketoacyl-CoA reductase expression is developmentally regulated. Studies on related enzymes such as HMG-CoA reductase in N. crassa show that enzymatic activities are low in conidia and increase threefold during the first 12 hours of stationary growth. Maximum specific activities occur when aerial hyphae and conidia first appear (approximately 2 days), but total activities peak later (3-4 days) . The expression patterns of KCR correlate with those of KCS, suggesting a coordinated regulation of fatty acid elongation enzymes. Research indicates that mutations in the KCS gene (equivalent to Bn-fae1 in Brassica) can impact both the transcription of KCR and the translation of 3-ketoacyl coenzyme A reductase .

  • Where is NCU11297 localized within Neurospora crassa cells?

    NCU11297 is primarily localized to the endoplasmic reticulum (ER) membrane, as indicated by its characterization as a "microsomal beta-keto-reductase" . This localization is consistent with the site of long-chain fatty acid synthesis, which takes place at the endoplasmic reticulum rather than in the cytosol (where synthesis of fatty acids with up to 16 carbon atoms occurs). The protein contains hydrophobic segments that likely serve as membrane anchors, facilitating its association with the ER membrane where it functions as part of the fatty acid elongation complex .

Advanced Research Questions

  • What are the optimal conditions for expressing and purifying recombinant NCU11297?

    For optimal expression and purification of recombinant NCU11297 from Neurospora crassa, a homologous expression system is recommended based on similar studies with other N. crassa enzymes. A Strep-tag®-based purification system has been successfully employed for recombinant N. crassa enzymes and could be adapted for NCU11297 .

    Methodology:

    • Expression: For homologous expression, transform N. crassa with a vector containing the NCU11297 gene under the control of a strong promoter such as the glyceraldehyde-3-phosphate dehydrogenase (GPD) promoter .

    • Culture conditions: Grow transformed N. crassa at 25-30°C for 2-3 days in minimal medium supplemented with appropriate carbon sources.

    • Purification: Use affinity chromatography with a Strep-Tactin® column for Strep-tagged protein.

    • Storage: Store purified enzyme in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage .

    Alternatively, heterologous expression in E. coli has been used for similar enzymes, though enzymatic activity is often significantly higher when purified from the native organism .

  • How can I measure the enzymatic activity of recombinant NCU11297?

    The activity of 3-ketoacyl-CoA reductase can be measured spectrophotometrically by monitoring the oxidation of NADPH at 340 nm.

    Assay methodology:

    1. Prepare reaction buffer (typically 100 mM potassium phosphate buffer, pH 7.0-7.5)

    2. Add NADPH (final concentration 200-250 μM)

    3. Add appropriate substrate (e.g., acetoacetyl-CoA, 3-ketoacyl-CoA) at various concentrations (10-500 μM)

    4. Pre-incubate at optimal temperature (28-30°C for N. crassa enzymes)

    5. Initiate reaction by adding purified enzyme

    6. Monitor decrease in absorbance at 340 nm (ε = 6,220 M⁻¹cm⁻¹)

    7. Calculate initial velocity using the formula: v₀ = -ΔA₃₄₀/Δt × 1/(ε × l) × V
      (where l is path length and V is reaction volume)

    For kinetics studies, vary substrate concentrations to determine Michaelis-Menten parameters (Km, Vmax) . Based on studies with similar enzymes, you should prepare substrate concentrations that span the hyperbolic velocity curve sufficiently to reliably calculate these parameters .

  • What are the kinetic parameters of NCU11297 and how do they compare to homologs?

    While specific kinetic parameters for NCU11297 are not directly reported in the provided literature, we can infer information from related 3-ketoacyl-CoA reductases and reductases in Neurospora crassa:

    EnzymeOrganismSubstrateKm (μM)CofactorpH optimumTemp. optimum
    NCU11297 (predicted)N. crassa3-ketoacyl-CoANot reportedNADPH~7.0-7.528-30°C
    HMG-CoA reductaseN. crassadl-HMG-CoA30NADPHNot reportedNot reported
    Mevalonate kinaseN. crassadl-mevalonate2800MgATP8.0-8.555°C
    17β-HSD12 (human homolog)HumanVarious 3-ketoacyl-CoAsVaries by chain lengthNADPH7.0-7.537°C

    The NCU11297 enzyme likely exhibits substrate specificity toward medium to long-chain 3-ketoacyl-CoA substrates, with a preference for NADPH as a cofactor similar to other reductases in the same family . Studies of homologous enzymes suggest that 3-ketoacyl-CoA reductases can enhance the activity of elongases (like ELOVL6) by inducing conformational changes or facilitating product removal .

  • How does phosphorylation affect the activity of reductases in Neurospora crassa?

    While phosphorylation of NCU11297 specifically hasn't been extensively documented, studies on other enzymes in Neurospora crassa provide insights into how post-translational modifications affect enzyme activity. Research on nitrate reductase (NR) from N. crassa showed that NR purified from the endogenous expression system contained two phosphorylation sites, and this phosphorylation was associated with enhanced enzymatic activity .

    For reductases involved in similar metabolic pathways, phosphorylation often serves as a regulatory mechanism. Short-term regulation of hydroxymethylglutaryl coenzyme A (HMG-CoA) reductase through reversible phosphorylation has been documented, with phosphorylation typically modulating reductase activity . By analogy, NCU11297 may be subject to similar regulatory mechanisms, where phosphorylation at specific serine or threonine residues could alter enzymatic activity in response to cellular needs for fatty acid synthesis.

  • How can I manipulate NCU11297 expression to study its role in fatty acid metabolism?

    To manipulate NCU11297 expression for studying its role in fatty acid metabolism:

    Overexpression strategies:

    1. Use strong constitutive promoters such as the glyceraldehyde-3-phosphate dehydrogenase (GPD) promoter

    2. Use inducible promoters such as the alcohol dehydrogenase (alcA) promoter for controlled expression

    Based on similar studies with HMG-CoA reductase in N. crassa, overexpression under the GPD promoter could increase product formation by up to 6-fold compared to wild-type strains, while the alcA promoter might yield a 3-fold increase .

    Gene silencing/knockout strategies:

    1. RNAi-based silencing (N. crassa has been used to study RNA interference mechanisms)

    2. CRISPR-Cas9 genome editing

    3. Homologous recombination-based gene replacement

    Experimental analysis:

    • Monitor fatty acid profiles using gas chromatography-mass spectrometry (GC-MS)

    • Measure transcriptional changes using RT-qPCR

    • Assess phenotypic changes including growth rate, lipid accumulation, and stress responses

    Research on similar enzymes suggests that silencing 3-ketoacyl-CoA reductase could lead to altered lipid profiles, potentially affecting cellular processes such as membrane formation and signaling pathways .

  • What are the structural features critical for NCU11297 function and how can they be studied?

    Critical structural features of NCU11297 can be inferred from studies of related enzymes:

    Key structural elements:

    • NADPH binding site: Contains a characteristic Rossmann fold motif

    • Catalytic residues: Likely includes conserved tyrosine and lysine residues forming a catalytic triad

    • Substrate binding pocket: Determines chain-length specificity

    Methodological approaches to study structure-function relationships:

    1. Site-directed mutagenesis:

      • Target conserved residues identified through sequence alignment

      • Based on studies of similar enzymes like KCS, mutations of conserved cysteine residues (particularly equivalent to C223 in related enzymes) and conserved histidine residues could completely abolish enzymatic activity

    2. Domain swapping experiments:

      • Create chimeric enzymes with domains from related reductases with different substrate specificities

      • The N-terminal region excluding transmembrane domains may be responsible for substrate specificity, as observed in similar enzymes

    3. Homology modeling:

      • Generate structural models based on crystallized homologs

      • Evaluate using Ramachandran maps and QMEAN scores

      • Identify solvent-accessible regions vs. buried residues

    4. X-ray crystallography or cryo-EM:

      • For direct structural determination of the purified enzyme

  • How does NCU11297 interact with other enzymes in the fatty acid elongation pathway?

    3-Ketoacyl-CoA reductase (NCU11297) functions as part of a multi-enzyme complex in the fatty acid elongation pathway. Understanding these interactions is crucial for comprehensive pathway engineering.

    Enzyme complex components and interactions:

    1. Sequential pathway components:

      • KCS (ketoacyl-CoA synthase): Precedes KCR in the pathway, providing the 3-ketoacyl-CoA substrate

      • HCD (hydroxyacyl-CoA dehydratase): Follows KCR, converting 3-hydroxyacyl-CoA to 2-enoyl-CoA

      • ECR (enoyl-CoA reductase): Final enzyme in the cycle, converting 2-enoyl-CoA to acyl-CoA

    2. Coordinated expression:

      • Research indicates a relationship between the expression of KCR and KCS, where mutations in KCS genes can impact the transcription of KCR genes and the translation of 3-ketoacyl coenzyme A reductase

      • KCR can enhance the activity of fatty acid elongases (such as ELOVL6), potentially by inducing conformational changes or facilitating product removal

    3. Metabolic channeling:

      • The elongation complex likely facilitates direct transfer of intermediates between enzymes

      • ECR affects the enzymatic activity of HCD and may represent the second rate-limiting step in fatty acid elongation after KCS

    Experimental approaches to study interactions:

    • Co-immunoprecipitation to identify physical interactions

    • Bimolecular fluorescence complementation (BiFC) for visualizing interactions in vivo

    • Yeast two-hybrid screening to map protein interaction networks

    • Cross-linking mass spectrometry to identify interaction interfaces

  • What are the effects of environmental conditions on NCU11297 expression and activity?

    Environmental factors significantly influence the expression and activity of metabolic enzymes in Neurospora crassa, including those involved in fatty acid metabolism.

    Key environmental factors:

    1. Growth phase effects:

      • Similar to HMG-CoA reductase and mevalonate kinase in N. crassa, NCU11297 activity likely varies with developmental stage

      • Enzyme activities are typically low in conidia and increase (up to threefold) during the first 12 hours of stationary growth

      • Maximum specific activities often coincide with aerial hyphae and conidia formation (approximately 2 days), while total activities may peak later (3-4 days)

    2. Temperature effects:

      • Optimum temperature for activity of related enzymes in N. crassa is around 28-30°C

      • Some N. crassa enzymes show unexpected temperature optima, such as mevalonate kinase with optimum activity at about 55°C

      • Thermal stability studies suggest NCU11297 likely has a high aliphatic index, indicating good thermostability

    3. pH dependence:

      • Optimal pH for activity likely falls in the range of 7.0-8.5, similar to other N. crassa enzymes

      • pH may affect both catalytic activity and protein stability

    4. Cofactor availability:

      • NADPH concentration directly impacts enzyme activity

      • Mg²⁺ ions may influence activity through effects on protein structure or substrate binding

    5. Carbon source effects:

      • Different carbon sources may trigger alternative metabolic pathways

      • This could indirectly affect NCU11297 expression through global metabolic regulation

    Methodological approach for environmental studies:

    • Culture N. crassa under varying conditions (temperature, pH, carbon sources)

    • Measure enzyme activity using the spectrophotometric assay described earlier

    • Quantify gene expression via RT-qPCR

    • Analyze protein levels through Western blotting with specific antibodies

Research Methods and Troubleshooting

  • What are common challenges in working with recombinant NCU11297 and how can they be addressed?

    Challenge 1: Low expression yields

    • Solution: Optimize codon usage for the expression host, use strong promoters (GPD promoter for homologous expression), and optimize growth conditions (temperature, media composition).

    • Alternative approach: Consider using a homologous expression system in N. crassa instead of heterologous expression, as this has been shown to yield significantly higher enzymatic activity for other N. crassa enzymes .

    Challenge 2: Protein insolubility

    • Solution: Express as a fusion protein with solubility-enhancing tags (MBP, SUMO), use lower induction temperatures, or include specific detergents for membrane-associated proteins.

    • Alternative approach: Use mild non-ionic detergents (0.1-1% Triton X-100) during extraction since NCU11297 is a membrane-associated protein.

    Challenge 3: Loss of activity during purification

    • Solution: Include stabilizers (glycerol, reducing agents), avoid freeze-thaw cycles, and store at -80°C for long-term storage. For working aliquots, store at 4°C for up to one week .

    • Alternative approach: Immobilize the enzyme on a suitable matrix to enhance stability.

    Challenge 4: Inconsistent activity measurements

    • Solution: Standardize assay conditions, ensure substrate quality, and include appropriate controls.

    • Alternative approach: Develop a coupled enzyme assay that produces a more stable signal.

    Challenge 5: Substrate availability

    • Solution: Synthesize substrates enzymatically using upstream enzymes, or source from commercial suppliers specializing in CoA derivatives.

    • Alternative approach: Use substrate analogs with better stability if appropriate for the experimental design.

  • How can I develop a high-throughput screening system for NCU11297 inhibitors or enhancers?

    Assay development strategy:

    1. Primary screening assay:

      • Adapt the NADPH-dependent spectrophotometric assay to 96- or 384-well format

      • Monitor NADPH oxidation at 340 nm continuously or at endpoints

      • Optimize enzyme and substrate concentrations for Z'-factor > 0.7

      • Include positive controls (known inhibitors of similar reductases) and negative controls (vehicle)

    2. Secondary verification assays:

      • Counter-screen against related reductases to assess selectivity

      • Evaluate dose-response relationships for promising hits

      • Determine inhibition mechanism (competitive, non-competitive, uncompetitive)

    3. Alternative detection methods:

      • Fluorescent assays using NADPH fluorescence (excitation 340 nm, emission 460 nm)

      • Coupled enzyme assays that generate colorimetric or fluorescent products

      • Mass spectrometry-based assays for direct product detection

    4. In silico screening preliminaries:

      • Generate homology model of NCU11297 based on related structures

      • Identify binding pockets using computational tools

      • Perform virtual screening of compound libraries against identified sites

    5. Cellular validation systems:

      • Develop N. crassa strains with reporter systems linked to fatty acid metabolism

      • Use lipidomic profiling to assess effects on fatty acid composition

  • How can I use NCU11297 for metabolic engineering of fatty acid production in Neurospora crassa?

    Strategic approaches for metabolic engineering:

    1. Overexpression strategies:

      • Use constitutive (GPD) or inducible (alcA) promoters as previously discussed

      • Co-express with other rate-limiting enzymes in the pathway

      • Balance expression levels to avoid metabolic bottlenecks

      Based on studies with HMG-CoA reductase in N. crassa, overexpression under the GPD promoter could increase product yields by up to 6-fold compared to wild-type strains .

    2. Pathway optimization:

      • Enhance substrate availability (acetyl-CoA and malonyl-CoA)

      • Reduce competing pathways through downregulation of branch-point enzymes

      • Optimize cofactor regeneration (NADPH) through enhanced pentose phosphate pathway

    3. Enzyme engineering:

      • Modify substrate specificity through targeted mutagenesis

      • Improve catalytic efficiency through protein engineering

      • Enhance stability under production conditions

    4. Production strain development:

      • Optimize culture conditions (carbon sources, temperature, pH)

      • Develop extraction and purification protocols for target fatty acids

      • Scale up to bioreactor conditions with controlled parameters

    5. Analytical methods for product characterization:

      • Gas chromatography-mass spectrometry (GC-MS) for fatty acid profiling

      • Liquid chromatography-mass spectrometry (LC-MS) for acyl-CoA intermediates

      • Thin-layer chromatography (TLC) for rapid screening

    Expected outcomes:
    Based on similar studies, engineering of the fatty acid elongation pathway could potentially increase production of specific long-chain fatty acids by 3-8 fold compared to wild-type strains .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.