Recombinant Neurospora crassa 3-ketodihydrosphingosine reductase tsc-10 (tsc-10)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Neurospora crassa 3-ketodihydrosphingosine reductase tsc-10 (tsc-10)

Recombinant Neurospora crassa 3-ketodihydrosphingosine reductase tsc-10 (tsc-10) is an enzyme that, in Neurospora crassa, is also known as 3-dehydrosphinganine reductase or KDS reductase . The gene is also referred to as gsl-3 . It participates in sphingolipid metabolism by catalyzing the reduction of 3-ketodihydrosphingosine to dihydrosphingosine .

Characteristics

  • Uniprot No: Q7RZR2

  • Immunogen Species: Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)

  • Source: Expressed in vitro in an E. coli system

  • Tag Info: Contains an N-terminal 10xHis-tag

  • Protein Length: Full length protein consisting of 325 amino acids

  • Molecular Weight: Approximately 36.7 kDa

  • Theoretical PI: 5.64

Amino Acid Sequence

The amino acid sequence of Recombinant Neurospora crassa 3-ketodihydrosphingosine reductase tsc-10 (tsc-10) is :
MGLFSSKNHMPVEGRTVLLTGASEGMGRSAAIQLSQKGANVILVSRNVGRLE
EALVDVRA
AAKNPSTQRFTYISADVSEHDYAAAVLAEAIAWNGGRSPDIVWCVAGMSTPLL
WTDDGSM
AAARRNMDVNYFGSAEMSRAILREWLAPENSTGPNGEPKHLVFTASMLALFAI
LGYGPYT
PTKWALRGLADTLAMEVNYYPDNPVKVHIVYPGTIVSPGYERENQTKPDITVEL
EKDEPA
ESPDTVARRAIAGLEAGKYFVDVSFLGRLMQCGIMGGSPRNNWVLDTLMGWL
IPIIYFFV LRGMNSTIVKWAREKGHPFTHPKKK

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
gsl-3; tsc10; NCU00302; 3-ketodihydrosphingosine reductase gsl-3; 3-dehydrosphinganine reductase; KDS reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
gsl-3
Target Protein Sequence
MGLFSSKNHMPVEGRTVLLTGASEGMGRSAAIQLSQKGANVILVSRNVGRLEEALVDVRA AAKNPSTQRFTYISADVSEHDYAAAVLAEAIAWNGGRSPDIVWCVAGMSTPLLWTDDGSM AAARRNMDVNYFGSAEMSRAILREWLAPENSTGPNGEPKHLVFTASMLALFAILGYGPYT PTKWALRGLADTLAMEVNYYPDNPVKVHIVYPGTIVSPGYERENQTKPDITVELEKDEPA ESPDTVARRAIAGLEAGKYFVDVSFLGRLMQCGIMGGSPRNNWVLDTLMGWLIPIIYFFV LRGMNSTIVKWAREKGHPFTHPKKK
Uniprot No.

Target Background

Function

Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).

Database Links

KEGG: ncr:NCU00302

Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the biochemical function of TSC10 in the sphingolipid biosynthesis pathway?

TSC10 catalyzes the second step in the de novo sphingolipid biosynthesis pathway. It specifically reduces 3-ketodihydrosphingosine to produce dihydrosphingosine (sphinganine) using NADPH as a cofactor . This reaction is essential for the production of all complex sphingolipids in the cell, which are critical components of cellular membranes and involved in various signaling pathways. The enzyme belongs to the short-chain dehydrogenase/reductase (SDR) superfamily, a large family of NAD(P)(H)-dependent oxidoreductases .

How is the TSC10 gene organized in the Neurospora crassa genome?

The TSC10 gene in Neurospora crassa has been thoroughly characterized as part of the Neurospora Genome Project. Like many genes in this organism, it contains introns and exons with specific regulatory elements . Molecularly validated knockouts of this gene are available through the Fungal Genetics Stock Center (FGSC), which maintains a comprehensive collection of Neurospora strains . Researchers should be aware that gene annotations in Neurospora have been updated over time, so it's essential to verify the current annotation when designing experiments targeting TSC10 .

What resources are available for studying TSC10 in Neurospora crassa?

Several resources are available for researchers studying TSC10 in Neurospora crassa:

  • Molecularly validated knockout strains from the Fungal Genetics Stock Center (FGSC)

  • Primers for creating knockouts, which can be mapped to the genome to identify exactly the region replaced with the knockout cassette

  • Microarrays for expression analysis

  • The complete genome sequence and annotation

  • SSR markers that can be used for genetic mapping

What is known about the crystal structure of fungal 3-ketodihydrosphingosine reductases?

While there was no experimentally determined structure for fungal 3-ketodihydrosphingosine reductases until recently, the crystal structure of TSC10 from Cryptococcus neoformans (cnTSC10) in complex with NADPH has now been reported . Key structural features include:

  • A Rossmann fold with a central seven-stranded β-sheet flanked by α-helices on both sides, typical of SDR family enzymes

  • Several disordered regions, including:

    • The segment connecting the serine and tyrosine residues of the catalytic triad

    • The "substrate loop"

    • The C-terminal region that often participates in homo-tetramerization in other SDRs

  • NADPH cofactor that is not fully ordered, indicating significant flexibility in the catalytic site

This flexibility is likely important for catalytic function, allowing the enzyme to undergo conformational changes during substrate binding and catalysis.

What oligomeric states does TSC10 form, and how might this affect function?

TSC10 from Cryptococcus neoformans exists predominantly as a dimer in solution, with a minor portion forming homo-tetramers . The crystal structure reveals that the homo-dimer interface involves:

  • Hydrophobic interactions

  • Hydrophilic interactions

  • Hydrogen bonds and salt bridges mediated by helices α4 and α5

  • Interactions via the loop connecting strand β4 and helix α4

Importantly, the residues forming hydrogen bonds and salt bridges in the dimer interface are not conserved between fungal TSC10 and mammalian KDSR proteins . This structural difference offers potential for developing inhibitors that selectively target fungal TSC10 dimerization without affecting the mammalian counterpart.

How can differences between fungal TSC10 and mammalian KDSR be exploited for antifungal development?

The structural differences between fungal TSC10 and mammalian KDSR (also called FVT-1) present opportunities for selective targeting:

  • Non-conserved residues at the dimer interface could be targeted to disrupt fungal TSC10 dimerization without affecting mammalian KDSR

  • Differences in the catalytic site or substrate-binding pocket might allow for selective inhibition

  • The C-terminal region involved in oligomerization could be targeted for selective disruption

This approach could potentially lead to novel antifungal agents with reduced toxicity to human cells.

What expression systems are most effective for producing recombinant Neurospora crassa TSC10?

Based on structural studies of related enzymes, effective expression systems include:

  • E. coli expression systems: Using vectors with strong promoters (T7, tac) and appropriate tags (His, GST) for purification. Consider codon optimization for improved expression.

  • Yeast expression systems: S. cerevisiae or P. pastoris can provide appropriate post-translational modifications and membrane environments.

  • Insect cell expression: Baculovirus-infected insect cells can be useful for obtaining well-folded eukaryotic proteins.

The choice should be guided by the specific research goals (e.g., structural studies, enzymatic assays, or protein-protein interaction analysis).

What methods are most effective for measuring TSC10 enzyme activity?

Several approaches can be used to measure TSC10 activity:

MethodAdvantagesLimitationsDetection Limit
NADPH oxidation (spectrophotometric)Real-time, simple setupIndirect measure, interference possible~5-10 μM NADPH
HPLC/LC-MS product detectionDirect product quantificationEquipment intensive, not real-time~0.1-1 μM product
Radiometric assaysHigh sensitivityRequires radioactive materials~0.01-0.1 μM
Lipidomic analysisComprehensive pathway analysisComplex data interpretationVaries by lipid species

For optimal results, researchers should:

  • Ensure substrate solubility (3-ketodihydrosphingosine is hydrophobic)

  • Maintain appropriate NADPH concentrations

  • Control reaction temperature and pH

  • Consider including detergents or lipid environments to mimic native conditions

How can researchers generate and validate TSC10 knockout strains in Neurospora crassa?

The Neurospora Genome Project has developed efficient protocols for gene knockouts:

  • Design knockout constructs: Using primers that target the TSC10 gene region for replacement with a selection marker

  • Transformation: Typically using polyethylene glycol-mediated transformation of conidia or electroporation

  • Selection: Using appropriate markers (typically hygromycin resistance)

  • Molecular validation: Through Southern blotting to confirm that the targeted gene was the one and only site of integration

  • Phenotypic analysis: Examining growth, morphology, and sphingolipid profiles

Researchers should be aware that gene annotations in Neurospora have changed over time, so it's essential to verify exactly which region has been replaced in existing knockout strains .

How can simple sequence repeats (SSRs) be utilized for genetic studies involving TSC10 in Neurospora crassa?

SSRs are valuable genetic markers that can be used for various studies involving TSC10:

  • Linkage mapping: SSRs can be used to build linkage maps that include the TSC10 locus. The polymorphic nature of SSRs makes them excellent markers for genetic mapping .

  • Population genetics: SSRs show size variation among natural accessions of N. crassa and can be analyzed using Polymorphic Index Content (PIC) and ANOVA analyses .

  • Evolutionary studies: The distribution and variation of SSRs near the TSC10 locus can provide insights into evolutionary forces acting on this genomic region.

Researchers have identified 2,749 SSRs of 963 types in the N. crassa genome, with tri-nucleotide SSRs being the most common in exonic regions .

What approaches can be used to investigate the integration of TSC10 function with broader cellular pathways?

To understand how TSC10 functions within broader cellular networks:

  • Metabolomic profiling: Analyze changes in sphingolipid profiles and related metabolites in wild-type versus TSC10 mutants

  • Transcriptomic analysis: Identify genes whose expression changes in response to TSC10 perturbation

  • Protein-protein interaction studies: Identify binding partners of TSC10 that might regulate its activity or localize it to specific cellular compartments

  • Genetic interaction screens: Identify genes that show synthetic lethal or synthetic rescue interactions with TSC10 mutations

  • Stress response studies: Examine how TSC10 function changes under various cellular stresses

How does the catalytic mechanism of TSC10 compare with other short-chain dehydrogenase/reductase (SDR) enzymes?

The catalytic mechanism of TSC10 likely follows the general mechanism of SDR enzymes:

  • Cofactor binding: NADPH binds to the Rossmann fold domain

  • Substrate binding: 3-ketodihydrosphingosine binds in the substrate-binding pocket

  • Hydride transfer: NADPH transfers a hydride to the ketone group

  • Proton donation: A conserved tyrosine residue likely donates a proton to complete the reduction

  • Product and cofactor release: Dihydrosphingosine and NADP+ are released

The disordered regions observed in the crystal structure, particularly the segment connecting the serine and tyrosine residues of the catalytic triad and the "substrate loop," likely undergo conformational changes during this process .

What statistical approaches are appropriate for analyzing TSC10 expression data in Neurospora crassa?

For analyzing TSC10 expression data, several statistical approaches are appropriate:

  • Log-linear modeling: As demonstrated in the analysis of SSR distributions, log-linear models can accommodate multiple factors simultaneously in a unified statistical framework . This approach could be used to analyze TSC10 expression across different conditions, tissues, or genetic backgrounds.

  • ANOVA: For comparing TSC10 expression or activity levels across multiple conditions or treatments. The statistical significance threshold should be adjusted for multiple comparisons.

  • Regression analysis: For identifying relationships between TSC10 expression/activity and other variables such as growth rate, stress levels, or metabolite concentrations.

Data from the analysis of SSRs in N. crassa provides an example of appropriate statistical approaches, showing how factors like chromosome, sequence type, and genomic location can be analyzed simultaneously .

How should researchers interpret structural data from fungal TSC10 in the context of enzyme function?

When interpreting structural data of fungal TSC10:

  • Structural flexibility: The disordered regions and partially ordered NADPH in the crystal structure indicate significant flexibility in the catalytic site of cnTSC10 . This flexibility is likely functionally important, allowing conformational changes during catalysis.

  • Oligomeric state: The predominant dimeric state with minor tetrameric forms suggests potential regulation through oligomerization .

  • Species differences: The non-conserved residues at the dimer interface between fungal TSC10 and mammalian KDSR indicate evolutionary divergence that might relate to functional differences .

  • Structure-function relationships: Mapping conserved residues onto the structure can help identify functionally important regions beyond the obvious catalytic and cofactor-binding sites.

What challenges exist in comparing TSC10 function across different fungal species?

Several challenges exist when comparing TSC10 across fungal species:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.