Recombinant Neurospora crassa 3-ketodihydrosphingosine reductase tsc-10 (tsc-10) is an enzyme that, in Neurospora crassa, is also known as 3-dehydrosphinganine reductase or KDS reductase . The gene is also referred to as gsl-3 . It participates in sphingolipid metabolism by catalyzing the reduction of 3-ketodihydrosphingosine to dihydrosphingosine .
Immunogen Species: Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Protein Length: Full length protein consisting of 325 amino acids
The amino acid sequence of Recombinant Neurospora crassa 3-ketodihydrosphingosine reductase tsc-10 (tsc-10) is :
MGLFSSKNHMPVEGRTVLLTGASEGMGRSAAIQLSQKGANVILVSRNVGRLE
EALVDVRA
AAKNPSTQRFTYISADVSEHDYAAAVLAEAIAWNGGRSPDIVWCVAGMSTPLL
WTDDGSM
AAARRNMDVNYFGSAEMSRAILREWLAPENSTGPNGEPKHLVFTASMLALFAI
LGYGPYT
PTKWALRGLADTLAMEVNYYPDNPVKVHIVYPGTIVSPGYERENQTKPDITVEL
EKDEPA
ESPDTVARRAIAGLEAGKYFVDVSFLGRLMQCGIMGGSPRNNWVLDTLMGWL
IPIIYFFV LRGMNSTIVKWAREKGHPFTHPKKK
Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS).
KEGG: ncr:NCU00302
TSC10 catalyzes the second step in the de novo sphingolipid biosynthesis pathway. It specifically reduces 3-ketodihydrosphingosine to produce dihydrosphingosine (sphinganine) using NADPH as a cofactor . This reaction is essential for the production of all complex sphingolipids in the cell, which are critical components of cellular membranes and involved in various signaling pathways. The enzyme belongs to the short-chain dehydrogenase/reductase (SDR) superfamily, a large family of NAD(P)(H)-dependent oxidoreductases .
The TSC10 gene in Neurospora crassa has been thoroughly characterized as part of the Neurospora Genome Project. Like many genes in this organism, it contains introns and exons with specific regulatory elements . Molecularly validated knockouts of this gene are available through the Fungal Genetics Stock Center (FGSC), which maintains a comprehensive collection of Neurospora strains . Researchers should be aware that gene annotations in Neurospora have been updated over time, so it's essential to verify the current annotation when designing experiments targeting TSC10 .
Several resources are available for researchers studying TSC10 in Neurospora crassa:
Molecularly validated knockout strains from the Fungal Genetics Stock Center (FGSC)
Primers for creating knockouts, which can be mapped to the genome to identify exactly the region replaced with the knockout cassette
While there was no experimentally determined structure for fungal 3-ketodihydrosphingosine reductases until recently, the crystal structure of TSC10 from Cryptococcus neoformans (cnTSC10) in complex with NADPH has now been reported . Key structural features include:
A Rossmann fold with a central seven-stranded β-sheet flanked by α-helices on both sides, typical of SDR family enzymes
Several disordered regions, including:
NADPH cofactor that is not fully ordered, indicating significant flexibility in the catalytic site
This flexibility is likely important for catalytic function, allowing the enzyme to undergo conformational changes during substrate binding and catalysis.
TSC10 from Cryptococcus neoformans exists predominantly as a dimer in solution, with a minor portion forming homo-tetramers . The crystal structure reveals that the homo-dimer interface involves:
Hydrophobic interactions
Hydrophilic interactions
Hydrogen bonds and salt bridges mediated by helices α4 and α5
Importantly, the residues forming hydrogen bonds and salt bridges in the dimer interface are not conserved between fungal TSC10 and mammalian KDSR proteins . This structural difference offers potential for developing inhibitors that selectively target fungal TSC10 dimerization without affecting the mammalian counterpart.
The structural differences between fungal TSC10 and mammalian KDSR (also called FVT-1) present opportunities for selective targeting:
Non-conserved residues at the dimer interface could be targeted to disrupt fungal TSC10 dimerization without affecting mammalian KDSR
Differences in the catalytic site or substrate-binding pocket might allow for selective inhibition
The C-terminal region involved in oligomerization could be targeted for selective disruption
This approach could potentially lead to novel antifungal agents with reduced toxicity to human cells.
Based on structural studies of related enzymes, effective expression systems include:
E. coli expression systems: Using vectors with strong promoters (T7, tac) and appropriate tags (His, GST) for purification. Consider codon optimization for improved expression.
Yeast expression systems: S. cerevisiae or P. pastoris can provide appropriate post-translational modifications and membrane environments.
Insect cell expression: Baculovirus-infected insect cells can be useful for obtaining well-folded eukaryotic proteins.
The choice should be guided by the specific research goals (e.g., structural studies, enzymatic assays, or protein-protein interaction analysis).
Several approaches can be used to measure TSC10 activity:
| Method | Advantages | Limitations | Detection Limit |
|---|---|---|---|
| NADPH oxidation (spectrophotometric) | Real-time, simple setup | Indirect measure, interference possible | ~5-10 μM NADPH |
| HPLC/LC-MS product detection | Direct product quantification | Equipment intensive, not real-time | ~0.1-1 μM product |
| Radiometric assays | High sensitivity | Requires radioactive materials | ~0.01-0.1 μM |
| Lipidomic analysis | Comprehensive pathway analysis | Complex data interpretation | Varies by lipid species |
For optimal results, researchers should:
Ensure substrate solubility (3-ketodihydrosphingosine is hydrophobic)
Maintain appropriate NADPH concentrations
Control reaction temperature and pH
Consider including detergents or lipid environments to mimic native conditions
The Neurospora Genome Project has developed efficient protocols for gene knockouts:
Design knockout constructs: Using primers that target the TSC10 gene region for replacement with a selection marker
Transformation: Typically using polyethylene glycol-mediated transformation of conidia or electroporation
Selection: Using appropriate markers (typically hygromycin resistance)
Molecular validation: Through Southern blotting to confirm that the targeted gene was the one and only site of integration
Phenotypic analysis: Examining growth, morphology, and sphingolipid profiles
Researchers should be aware that gene annotations in Neurospora have changed over time, so it's essential to verify exactly which region has been replaced in existing knockout strains .
SSRs are valuable genetic markers that can be used for various studies involving TSC10:
Linkage mapping: SSRs can be used to build linkage maps that include the TSC10 locus. The polymorphic nature of SSRs makes them excellent markers for genetic mapping .
Population genetics: SSRs show size variation among natural accessions of N. crassa and can be analyzed using Polymorphic Index Content (PIC) and ANOVA analyses .
Evolutionary studies: The distribution and variation of SSRs near the TSC10 locus can provide insights into evolutionary forces acting on this genomic region.
Researchers have identified 2,749 SSRs of 963 types in the N. crassa genome, with tri-nucleotide SSRs being the most common in exonic regions .
To understand how TSC10 functions within broader cellular networks:
Metabolomic profiling: Analyze changes in sphingolipid profiles and related metabolites in wild-type versus TSC10 mutants
Transcriptomic analysis: Identify genes whose expression changes in response to TSC10 perturbation
Protein-protein interaction studies: Identify binding partners of TSC10 that might regulate its activity or localize it to specific cellular compartments
Genetic interaction screens: Identify genes that show synthetic lethal or synthetic rescue interactions with TSC10 mutations
Stress response studies: Examine how TSC10 function changes under various cellular stresses
The catalytic mechanism of TSC10 likely follows the general mechanism of SDR enzymes:
Substrate binding: 3-ketodihydrosphingosine binds in the substrate-binding pocket
Hydride transfer: NADPH transfers a hydride to the ketone group
Proton donation: A conserved tyrosine residue likely donates a proton to complete the reduction
Product and cofactor release: Dihydrosphingosine and NADP+ are released
The disordered regions observed in the crystal structure, particularly the segment connecting the serine and tyrosine residues of the catalytic triad and the "substrate loop," likely undergo conformational changes during this process .
For analyzing TSC10 expression data, several statistical approaches are appropriate:
Log-linear modeling: As demonstrated in the analysis of SSR distributions, log-linear models can accommodate multiple factors simultaneously in a unified statistical framework . This approach could be used to analyze TSC10 expression across different conditions, tissues, or genetic backgrounds.
ANOVA: For comparing TSC10 expression or activity levels across multiple conditions or treatments. The statistical significance threshold should be adjusted for multiple comparisons.
Regression analysis: For identifying relationships between TSC10 expression/activity and other variables such as growth rate, stress levels, or metabolite concentrations.
Data from the analysis of SSRs in N. crassa provides an example of appropriate statistical approaches, showing how factors like chromosome, sequence type, and genomic location can be analyzed simultaneously .
When interpreting structural data of fungal TSC10:
Structural flexibility: The disordered regions and partially ordered NADPH in the crystal structure indicate significant flexibility in the catalytic site of cnTSC10 . This flexibility is likely functionally important, allowing conformational changes during catalysis.
Oligomeric state: The predominant dimeric state with minor tetrameric forms suggests potential regulation through oligomerization .
Species differences: The non-conserved residues at the dimer interface between fungal TSC10 and mammalian KDSR indicate evolutionary divergence that might relate to functional differences .
Structure-function relationships: Mapping conserved residues onto the structure can help identify functionally important regions beyond the obvious catalytic and cofactor-binding sites.
Several challenges exist when comparing TSC10 across fungal species: