Recombinant Neurospora crassa ADP,ATP carrier protein (acp)

Shipped with Ice Packs
In Stock

Description

Gene and mRNA Structure

FeatureDescriptionSource
Gene copy numberSingle copy in the genome
IntronsContains two short introns
Promoter regionPyrimidine-rich sequence
mRNA 5' UTR46 base pairs (bp)
mRNA 3' UTR219 bp
Coding ORFOpen reading frame encoding 313 amino acids
Protein homology148 residues homologous to beef heart ADP/ATP carrier

The gene’s nucleotide sequence and mRNA structure were deduced through cDNA cloning and S1 nuclease mapping .

Expression and Purification

Recombinant AAC is expressed in E. coli and purified for functional studies:

ParameterDetailsSource
Expression systemE. coli (mammalian AAC cannot be expressed here)
Purification methodIsolation from lipid bilayers or reconstituted into artificial membranes
YieldSufficient for single-channel patch-clamp experiments

The recombinant protein lacks mitochondrial contaminants, enabling precise functional analysis .

Functional Properties

Recombinant AAC exhibits channel-like behavior critical for mitochondrial permeability transition (mPT):

PropertyDetailsSource
ConductanceUp to 600 pS (picosiemens) in Ca²⁺-dependent channels
Voltage gatingActivated at >150 mV, with polar asymmetry
InhibitorsADP, bongkrekic acid (BKA); not inhibited by carboxyatractylate
Cyclophilin interactionCyclophilin suppresses gating; cyclosporin A reverses this effect
Redox sensitivityPro-oxidants (e.g., tert-butyl hydroperoxide) suppress voltage gating

Patch-clamp experiments confirm AAC’s role as a core component of the mPT pore, regulated by Ca²⁺, ADP, and cyclophilin .

Applications and Research Implications

  1. Mitochondrial Permeability Transition (mPT): AAC’s channel activity is central to mPT pore formation, linking mitochondrial dysfunction to apoptosis .

  2. Therapeutic Targets: Cyclosporin A’s inhibition of cyclophilin-AAC interaction highlights potential for modulating mPT in diseases like ischemia-reperfusion injury .

  3. Biophysical Studies: Recombinant AAC enables precise analysis of voltage-dependent gating and ion flux .

Note on Terminology

The term “ACP” (often used for acyl carrier proteins) is distinct from AAC (ADP/ATP carrier). This article focuses exclusively on the recombinant AAC protein, not the unrelated mitochondrial acyl carrier protein implicated in iron-sulfur cluster biogenesis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery estimates.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is dependent on various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
aac; acp; B22K18.180; NCU09477; ADP,ATP carrier protein; ADP/ATP translocase; Adenine nucleotide translocator; ANT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-313
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
aac
Target Protein Sequence
MAEQQKVLGMPPFVADFLMGGVSAAVSKTAAAPIERIKLLVQNQDEMIRAGRLDRRYNGI IDCFKRTTADEGVMALWRGNTANVIRYFPTQALNFAFRDKFKKMFGYKKDVDGYWKWMAG NLASGGAAGATSLLFVYSLDYARTRLANDAKSAKKGGERQFNGLVDVYRKTIASDGIAGL YRGFGPSVAGIVVYRGLYFGLYDSIKPVLLVGDLKNNFLASFALGWCVTTAAGIASYPLD TIRRRMMMTSGEAVKYKSSFDAASQIVAKEGVKSLFKGAGANILRGVAGAGVLSIYDQLQ VLLFGKAFKGGSG
Uniprot No.

Target Background

Function
ADP:ATP antiporter that mediates import of ADP into the mitochondrial matrix for ATP synthesis, and export of ATP out to fuel the cell. It cycles between the cytoplasmic-open state (c-state) and the matrix-open state (m-state), operating by the alternating access mechanism with a single substrate-binding site intermittently exposed to either the cytosolic (c-state) or matrix (m-state) side of the inner mitochondrial membrane.
Database Links

KEGG: ncr:NCU09477

Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of the Neurospora crassa ADP/ATP carrier protein?

The ADP/ATP carrier protein from Neurospora crassa is a mitochondrial membrane protein that catalyzes the exchange of ADP and ATP across the mitochondrial inner membrane. The functional carrier is composed of two identical subunits with a molecular weight of approximately 30,000-33,000 Da, depending on the species . The carrier contains 313 amino acid residues and shares significant homology (148 positions) with the established primary structure of the beef heart carrier .

The protein has a tripartite structure consisting of three similar domains, each containing the signature motif Px[DE]xx[KR]. This structural arrangement creates a central translocation pathway with threefold pseudosymmetry. The carrier cycles between two conformational states: the cytoplasmic state (c-state), which accepts ADP from the cytoplasm, and the matrix state (m-state), which accepts ATP from the mitochondrial matrix .

How was the ADP/ATP carrier gene from N. crassa initially identified and cloned?

The cDNA complementary to the mRNA of the ADP/ATP carrier from Neurospora crassa was identified through a methodical screening approach. Researchers hybridized total polyadenylated RNA to pools of 96 cDNA recombinant plasmids, followed by cell-free translation of hybridization-selected mRNA . This technique allowed for the identification of carrier cDNAs, which were subsequently found at a frequency of 0.2-0.3% through colony filter hybridization .

The gene of the carrier was then cloned and isolated on a 4.6-kbp EcoRI fragment of total Neurospora DNA. Researchers determined the start of the mRNA through S1 nuclease mapping, which enabled them to deduce the primary structure of the gene, mRNA, and the protein from the nucleotide sequences of the cDNA and genomic DNA .

What is the genomic organization of the N. crassa ADP/ATP carrier gene?

The ADP/ATP carrier gene in Neurospora crassa exists as a single copy in the genome, with no related genes present . The gene structure includes:

  • Two short introns interrupting the coding sequence

  • A pyrimidine-rich promoter region preceding the transcription start site

  • A mRNA with a 46-bp 5' untranslated region and a 219-bp 3' untranslated region

  • An open reading frame encoding 313 amino acid residues

This genomic organization reflects the typical eukaryotic gene structure with distinct regulatory and coding elements.

How does the sequence conservation of ADP/ATP carriers reflect evolutionary relationships?

The amino acid sequence of the Neurospora crassa ADP/ATP carrier shows significant conservation with other species, particularly at functional domains. Specifically, the N. crassa carrier protein shares homology in 148 positions with the beef heart carrier . This conservation pattern suggests that:

  • The core functional domains responsible for transport activity have been maintained throughout evolution

  • The conservation of specific residues correlates with their roles in substrate binding, conformational changes, and transport mechanics

  • The carrier family likely evolved from a common ancestral protein through gene duplication events

The evolutionary conservation is particularly evident in the Px[DE]xx[KR] signature motif, which is present in all mitochondrial carriers and plays a crucial role in their mechanism of action .

What methodologies can be used for genetic modification of the N. crassa ADP/ATP carrier?

Recent developments in genetic modification techniques have significantly enhanced our ability to study the Neurospora crassa ADP/ATP carrier. A particularly effective approach is the CRISPR/Cas9 system, which offers several advantages over traditional methods:

  • A user-friendly CRISPR/Cas9 system has been developed specifically for N. crassa that incorporates the cas9 sequence into the fungal genome, with naked guide RNA introduced via electroporation

  • This system eliminates the need for constructing multiple vectors, accelerating the mutagenesis process

  • Using cyclosporin-resistant-1 (csr-1) as a selectable marker gene, researchers have achieved 100% editing efficiency under selection conditions

The methodology involves:

  • Integration of cas9 sequence at the his-3-locus of N. crassa under the control of the ccg1-promotor

  • Design of specific gRNAs targeting the gene of interest

  • Introduction of gRNAs via electroporation

  • Selection of transformants and verification of mutations by PCR and sequencing

This approach can be adapted for studying the ADP/ATP carrier by designing gRNAs specific to the carrier gene.

What structural features contribute to the alternating-access mechanism in mitochondrial ADP/ATP carriers?

The alternating-access mechanism in mitochondrial ADP/ATP carriers, including the N. crassa carrier, involves several key structural elements:

  • Three domains arranged with threefold pseudosymmetry around a central translocation pathway

  • Matrix salt-bridge network: Three interdomain salt-bridge interactions close the carrier at the matrix side in the cytoplasmic state

  • Glutamine braces: These conserved residues strengthen the matrix network and contribute to an energy barrier that prevents conversion to the matrix state unless substrate binding occurs

  • Cytoplasmic salt-bridge network: Forms during the transport cycle, as demonstrated by functional analysis of mutants with charge-reversed networks

The interconversion between states involves movement of the even-numbered α-helices across the surfaces of the odd-numbered α-helices by rotation of the domains. The odd-numbered α-helices have an L-shape, with proline or serine residues at the kinks, which functions as a lever-arm, coupling the substrate-induced disruption of the matrix network to the formation of the cytoplasmic network .

This simultaneous movement of three domains around a central translocation pathway constitutes a unique mechanism among transport proteins and provides the structural basis for the strict equimolar exchange of ADP and ATP.

What are the key residues involved in substrate binding and specificity in ADP/ATP carriers?

The substrate binding site in ADP/ATP carriers is located in the central cavity, corresponding to the middle of the membrane. Based on studies with yeast ADP/ATP carriers (which share structural similarities with N. crassa), the key residues involved in ADP binding include:

Adenine Binding Pocket:

  • Gly199, Ile200, and Tyr203 form a hydrophobic pocket for the adenine moiety

  • The major interaction is an aromatic stacking arrangement with Tyr203

Phosphate Binding:

  • Arg96, Arg294, and Lys38 are likely to bind the two phosphates carrying three negative charges

  • Arg253 may also be involved in phosphate binding

Table 1: Key Residues in ADP/ATP Carrier Substrate Binding

FunctionResidues in Yeast Aac2pInteraction Type
Adenine bindingGly199, Ile200, Tyr203Hydrophobic pocket, aromatic stacking
Phosphate bindingArg96, Arg294, Lys38, (Arg253)Electrostatic interactions with negative charges
Network stabilizationThree interdomain salt-bridgesIonic interactions
Network bracingConserved glutamine residuesHydrogen bonding

The interaction energy of substrate binding matches that of the extended matrix salt-bridge network, allowing conversion to the m-state only when substrate is bound, enforcing a strict equimolar exchange mechanism .

How do interdomain salt-bridge interactions regulate the conformational changes of ADP/ATP carriers?

Interdomain salt-bridge interactions play a crucial role in regulating conformational changes of ADP/ATP carriers through an energy barrier mechanism:

  • Matrix salt-bridge network: In the cytoplasmic state, three interdomain salt-bridge interactions close the carrier at the matrix side. One of these salt bridges is braced by a glutamine residue, which increases the stability of the network

  • Energy barrier function: The interactions of the salt-bridge network provide an energy barrier that must be overcome by substrate binding for translocation to occur. The glutamine braces strengthen this interaction network and increase the magnitude of the energy barrier

  • Conversion mechanism: When ADP binds in the central cavity, the interaction energy matches that of the extended matrix salt-bridge network, allowing conversion to the matrix state only when substrate is bound

  • Cytoplasmic salt-bridge network: A second salt-bridge network forms at the cytoplasmic side during the transport cycle, as demonstrated by functional analysis of mutants with charge-reversed networks

The number of glutamine braces differs between mitochondrial carriers with different functions, suggesting that the interaction energy of the extended network varies between carriers to match their specific substrates and transport mechanisms .

What analytical techniques are most effective for studying the structure-function relationship of recombinant N. crassa ADP/ATP carrier?

Several analytical techniques have proven effective for studying the structure-function relationships of mitochondrial ADP/ATP carriers, including the N. crassa carrier:

  • X-ray Crystallography and Cryo-EM:

    • Provides atomic-level structures of the carrier in different conformational states

    • Has been successfully used for determining the structures of yeast mitochondrial ADP/ATP carriers in the cytoplasmic state

  • Site-Directed Mutagenesis:

    • Allows for systematic analysis of key residues involved in substrate binding and transport

    • Particularly useful for studying the functional significance of residues in the salt-bridge networks

  • CRISPR/Cas9 Gene Editing:

    • The newly designed N. crassa CRISPR/Cas9 system enables precise genetic modifications

    • Achieves high editing efficiency when used with appropriate selection markers

  • Solvent Accessibility Analysis:

    • Identifies residues involved in stability, conformational rigidity, and functional interactions

    • Studies on related proteins like Carboxypeptidase A1 have shown that residues with zero accessibility to the solvent are involved in structural stability, while residues with maximum accessibility are considered functional

  • Projection Structure Analysis in Lipid Environments:

    • Reveals the arrangement of transmembrane α-helices surrounding the central translocation pathway

  • Functional Transport Assays:

    • Measures substrate transport activity in reconstituted systems or intact mitochondria

    • Essential for correlating structural features with transport function

How can protein modeling approaches enhance our understanding of the N. crassa ADP/ATP carrier?

Computational and protein modeling approaches offer valuable insights into the structure and function of the N. crassa ADP/ATP carrier:

  • Comparative Modeling:

    • Utilizing the known structures of homologous proteins (such as the bovine or yeast ADP/ATP carriers) as templates to model the N. crassa carrier

    • Allows prediction of secondary and tertiary structures in the absence of experimental structures

  • Molecular Dynamics Simulations:

    • Simulates the dynamic behavior of the carrier in a membrane environment

    • Provides insights into conformational changes during the transport cycle

    • Can reveal the energetics of substrate binding and transport

  • Surface and Nucleus Accessibility Analysis:

    • Identifies residues with varying degrees of solvent accessibility

    • Residues with zero accessibility are likely involved in structural stability

    • Residues with maximum accessibility are often functional sites

  • Domain Structure Analysis:

    • Examines properties of interdomain interfaces to understand the mechanics of interconversion between states

    • Studies of yeast carriers have shown that domain rotation is key to the transport mechanism

  • Evolutionary Conservation Analysis:

    • Identifies conserved residues across species, which often correlate with functional importance

    • The N. crassa carrier shares homology in 148 positions with the beef heart carrier, providing clues about critical functional regions

What expression systems are optimal for producing recombinant N. crassa ADP/ATP carrier?

The choice of expression system for producing recombinant N. crassa ADP/ATP carrier depends on the research objectives and required protein characteristics:

  • Homologous Expression in N. crassa:

    • Advantages: Native post-translational modifications and membrane environment

    • Implementation: Can utilize the CRISPR/Cas9 system with the ccg1 promoter for controlled expression

    • Best for: Functional studies in the native context

  • Yeast Expression Systems:

    • Advantages: Eukaryotic processing, relatively high yields, and proper membrane integration

    • Implementation: Can use strong inducible promoters like GAL1 in S. cerevisiae

    • Best for: Structural studies requiring moderate amounts of protein

  • Bacterial Expression Systems:

    • Advantages: High yields, simplicity, and cost-effectiveness

    • Challenges: May require optimization of codon usage and solubilization strategies

    • Best for: Biochemical studies requiring large amounts of protein

When selecting an expression system, researchers should consider:

  • The need for post-translational modifications

  • Required protein folding and membrane integration

  • Experimental yield requirements

  • Downstream purification strategies

How can researchers overcome challenges in functional characterization of the recombinant carrier?

Functional characterization of recombinant ADP/ATP carriers presents several challenges that can be addressed through strategic approaches:

  • Protein Stability and Solubility:

    • Challenge: Maintaining the native conformation during purification

    • Solution: Use mild detergents or lipid nanodiscs for extraction and purification

  • Reconstitution into Functional Systems:

    • Challenge: Ensuring proper membrane orientation and activity

    • Solution: Reconstitute purified protein into liposomes or proteoliposomes for transport assays

  • Activity Measurement:

    • Challenge: Quantifying ADP/ATP exchange in vitro

    • Solution: Employ radioisotope-labeled substrates or fluorescent ATP analogs for transport assays

  • Conformational State Analysis:

    • Challenge: Capturing the carrier in specific conformational states

    • Solution: Use specific inhibitors like carboxyatractyloside (CATR) to lock the carrier in the c-state

  • Mutagenesis Analysis:

    • Challenge: Determining the effect of mutations on function

    • Solution: Implement CRISPR/Cas9 system for precise genetic modifications and assess effects using transport assays

  • Structural Analysis:

    • Challenge: Obtaining structural information on membrane proteins

    • Solution: Utilize detergent-solubilized protein for cryo-EM or X-ray crystallography, or employ computational modeling based on homologous structures

How does understanding the N. crassa ADP/ATP carrier contribute to mitochondrial disease research?

The study of the N. crassa ADP/ATP carrier provides valuable insights for mitochondrial disease research:

  • Model System Advantages:

    • N. crassa serves as an excellent model organism due to its rapid growth and diverse biology

    • The conserved features of ADP/ATP carriers across species allow for translational insights

  • Disease Mechanism Insights:

    • Understanding how mutations affect carrier function helps explain the molecular basis of mitochondrial diseases

    • The work on carrier structures helps understand "how mutations can affect the function of these proteins, resulting in a range of neuromuscular, metabolic and developmental diseases"

  • Therapeutic Target Identification:

    • Detailed knowledge of carrier structure and mechanism enables the rational design of therapeutics

    • Identification of specific binding sites and conformational changes provides targets for drug development

  • Biomarker Development:

    • Characterization of carrier variants may lead to identification of disease-specific biomarkers

    • Understanding functional changes can inform diagnostic approaches

What emerging technologies might enhance future research on the N. crassa ADP/ATP carrier?

Several emerging technologies show promise for advancing research on the N. crassa ADP/ATP carrier:

The continuous development of these technologies promises to further our understanding of the structure, function, and regulation of the N. crassa ADP/ATP carrier, with implications for both basic science and medical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.