Recombinant Neurospora crassa Altered inheritance of mitochondria protein 31, mitochondrial (aim-31)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Neurospora crassa Altered Inheritance of Mitochondria Protein 31 (aim-31)

The recombinant Neurospora crassa Altered Inheritance of Mitochondria Protein 31 (aim-31) is a full-length mitochondrial protein expressed in E. coli with an N-terminal His tag for purification . This protein, encoded by the gene Q7S455 (1-221 amino acids), was originally identified in genetic screens targeting defects in mitochondrial DNA (mtDNA) inheritance . Its recombinant form is commercially available (Cat. No. RFL5069NF) and serves as a tool for studying mitochondrial complex assembly, mtDNA dynamics, and cytochrome bc1-COX supercomplex interactions .

Biochemical Characteristics of Recombinant aim-31

PropertySpecification
Source OrganismNeurospora crassa
Gene IDQ7S455
Length1–221 amino acids (full-length)
TagN-terminal His tag
Expression SystemE. coli
ApplicationMitochondrial complex assembly studies, mtDNA inheritance research

Key Features:

  • Structural Role: Associates with the cytochrome bc1-COX supercomplex, particularly interacting with Cox3 in the COX complex .

  • Functional Partners: Shares overlapping roles with Aim38, another mitochondrial protein involved in supercomplex stability .

Interaction with Mitochondrial Complexes

aim-31 binds to the cytochrome bc1-COX supercomplex, bridging the cytochrome bc1 and COX complexes. Biochemical studies reveal:

  • Tight Binding to COX: aim-31 shows stronger association with the COX complex compared to the cytochrome bc1 domain .

  • Proximity to Cox3: Crosslinking experiments confirm physical interactions between aim-31 and Cox3, a core subunit of COX .

Overlap with Aim38

aim-31 and Aim38 (a homologous mitochondrial protein) exhibit partial functional redundancy:

  • Independent Binding: Both proteins independently stabilize the cytochrome bc1-COX supercomplex .

  • Distinct Specificity: aim-31 preferentially interacts with COX, while Aim38 may target other complexes .

Mechanistic Studies

Recombinant aim-31 is used to:

  • Map Protein-Protein Interactions: Co-purification assays identify binding partners in mitochondrial supercomplexes .

  • Investigate mtDNA Inheritance: Mutant strains lacking aim-31 exhibit defects in mtDNA segregation and supercomplex assembly .

Comparative Analysis with Yeast Homologs

While Saccharomyces cerevisiae Aim31 belongs to the Hig1 protein family, N. crassa aim-31 diverges in function:

  • Evolutionary Divergence: N. crassa aim-31 specializes in COX complex interactions, unlike yeast homologs .

Table 1: Interaction Profile of aim-31 with Mitochondrial Complexes

ComplexInteraction StrengthKey Binding PartnersReference
COXHighCox3, cytochrome bc1
Cytochrome bc1ModerateUndetermined

Table 2: Functional Overlap Between aim-31 and Aim38

Functionaim-31Aim38
Supercomplex StabilityCOX-focusedBroader complex interactions
Binding SpecificityCox3-dependentIndependent of Cox3

Product Specs

Form
Supplied as a lyophilized powder.

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if necessary. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

If you require a specific tag type, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
rcf1; NCU02451; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
rcf1
Target Protein Sequence
MPNSTDNQGSAPPGLSSRPLPSSFDDNADFYNENGFQKVSRRLREEPLIPIGCIATVAAF TGAYRAMRRGDHEQVQRMFRARVAAQAFTVVAMVAGSWYYAADRQKQKELWKLKEQQDAE EKRQKWIRELEVRDAEDKALQERLEKRRKKKAERDSAAGAPDGVAAQAQAAYADAKEKVS SPAGDVAPEDPNKSNITGVRERLPTWLGGSKGADGSSRDKN
Uniprot No.

Target Background

Function

Function: Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links

KEGG: ncr:NCU02451

Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How is AIM-31 related to other mitochondrial inheritance proteins in fungi?

AIM-31 belongs to a broader network of proteins involved in mitochondrial inheritance in fungi. In Saccharomyces cerevisiae, proteins such as Mmr1 and Ypt11 are known to be essential for proper mitochondrial inheritance. Recent research has shown that Mmr1 contributes more significantly to mitochondrial inheritance than Ypt11, with deletion of Mmr1 resulting in more severe mitochondrial inheritance defects .

Comparative data on mitochondrial inheritance in yeast versus N. crassa demonstrates different protein requirements:

OrganismKey Mitochondrial Inheritance ProteinsInheritance Defect Severity
S. cerevisiaeMmr1, Ypt11, Myo2Δmmr1 > Δypt11
N. crassaAIM-31, others not fully characterizedUnder investigation

While specific interaction studies between AIM-31 and other N. crassa proteins haven't been fully elucidated, it likely functions in parallel pathways to those observed in other fungi .

What are the recommended methods for expressing recombinant AIM-31?

For researchers seeking to express recombinant AIM-31, several expression systems can be employed:

Bacterial Expression:

  • Clone the aim-31 gene (NCU02451) into an expression vector containing an appropriate tag (His, GST, or MBP) to facilitate purification

  • Transform into E. coli expression strains (BL21(DE3) or derivatives)

  • Induce expression with IPTG at lower temperatures (16-20°C) to enhance solubility

  • Lyse cells and purify using affinity chromatography

Fungal Expression:
Because mitochondrial proteins often require specific post-translational modifications, expression in a fungal host may yield better results:

  • Use a Neurospora-compatible expression vector with a strong promoter (e.g., ccg-1 promoter)

  • Transform into a Neurospora strain using electroporation

  • Incorporate a fluorescent tag (e.g., GFP) for localization studies

  • Extract protein using specialized mitochondrial isolation protocols

When expressing mitochondrial proteins, researchers should note that expression and purification of full-length recombinant mitochondrial proteins can be challenging. As observed with other mitochondrial proteins like MSH1, expression of partial domains may be more successful than attempting to express the entire protein .

How can I create and validate AIM-31 knockout strains in Neurospora crassa?

The CRISPR/Cas9 system offers an efficient approach for generating AIM-31 knockout strains:

Step-by-Step Protocol:

  • CRISPR/Cas9 System Design:

    • Integrate cas9 into the N. crassa genome under the control of the ccg1 promoter

    • Design gRNA targeting the aim-31 gene

    • Use naked gRNA introduction via electroporation

  • Transformation and Selection:

    • Prepare a repair template with homology arms flanking the targeted region

    • Co-transform Cas9-expressing strain with the gRNA and repair template

    • Select transformants using appropriate markers

  • Validation Methods:

    • PCR confirmation of gene disruption

    • Sequencing to confirm mutations at the target site

    • Western blot to verify absence of AIM-31 protein

    • Phenotypic characterization focusing on mitochondrial inheritance

Recent developments in CRISPR/Cas9 techniques for N. crassa have achieved up to 100% editing efficiency when targeting selectable markers like csr-1 . The user-friendly CRISPR/Cas9 system eliminates the need for constructing multiple vectors, significantly speeding up the mutagenesis process.

What techniques are most effective for studying AIM-31 localization in mitochondria?

To study AIM-31 localization in mitochondria, several complementary approaches can be employed:

1. Fluorescent Protein Tagging:

  • Create a C-terminal or N-terminal GFP fusion of AIM-31 using homologous recombination

  • Use the auxin-inducible degradation system to enable conditional depletion for functional studies

  • Confirm that the GFP tag doesn't disrupt normal protein function through complementation assays

2. Immunofluorescence Microscopy:

  • Generate antibodies against AIM-31 or use epitope tags (e.g., FLAG)

  • Co-stain with mitochondrial markers such as MitoTracker

  • Perform co-localization analysis with other mitochondrial compartment markers

3. Biochemical Fractionation:

  • Isolate mitochondria from N. crassa using differential centrifugation

  • Further separate into outer membrane, inner membrane, and matrix fractions

  • Detect AIM-31 in fractions using Western blotting

  • Compare with known markers of different mitochondrial compartments

4. Immuno-electron Microscopy:

  • Use gold-labeled antibodies against AIM-31

  • Visualize precise localization within mitochondrial subcompartments

For dynamic studies, conditional depletion systems similar to those described for UNC-31 in C. elegans could be adapted for AIM-31 . The localization data should be correlated with functional studies to understand how AIM-31's subcellular position relates to its role in mitochondrial inheritance.

How does AIM-31 contribute to mitochondrial inheritance mechanisms?

The specific mechanisms by which AIM-31 contributes to mitochondrial inheritance in N. crassa are still being elucidated, but insights can be drawn from studies of mitochondrial inheritance in other fungi:

Potential Mechanisms Based on Comparative Studies:

  • Mitochondrial Transport:
    AIM-31 may function similarly to Mmr1 in S. cerevisiae, which facilitates mitochondrial transport along actin cables via interaction with the myosin motor protein Myo2. Research has shown that the volume of mitochondria inherited during cell division is critical for maintaining mitochondrial DNA integrity, with defects in inheritance proteins correlating with increased petite frequency .

  • Mitochondrial Tethering:
    AIM-31 could potentially anchor mitochondria at specific cellular locations during division, ensuring proper distribution between mother and daughter cells.

  • Mitochondrial-Cytoskeletal Interactions:
    Like other mitochondrial inheritance proteins, AIM-31 might mediate interactions between mitochondria and cytoskeletal elements.

Recent studies in yeast have revealed a striking correlation between the volume of inherited mitochondria and mtDNA stability:

StrainNormalized Bud Mitochondrial VolumePetite Frequency (%)
Wild-type1.0~1%
Δypt110.9~2%
Δmmr10.5~20%
Δmmr1 Δypt11<0.2>40%

This suggests that proteins like AIM-31 in N. crassa may play crucial roles in ensuring sufficient mitochondrial volume is inherited to maintain mtDNA integrity across generations .

What phenotypes are associated with AIM-31 mutation or deletion?

While specific phenotypes associated with AIM-31 mutation in N. crassa are still being characterized, insights can be drawn from studies of related proteins in other fungi:

Predicted Phenotypes Based on Comparative Studies:

  • Mitochondrial Distribution Defects:

    • Abnormal accumulation of mitochondria in mother cells

    • Reduced mitochondrial content in daughter cells or hyphal tips

    • Uneven distribution of mitochondria throughout the mycelium

  • Mitochondrial DNA Stability:

    • Increased frequency of mitochondrial DNA mutations or loss

    • Reduced mtDNA copy number

    • Altered nucleoid distribution patterns

  • Growth and Development:

    • Reduced growth rate, particularly under respiratory conditions

    • Altered colony morphology

    • Defects in asexual or sexual reproduction

  • Metabolic Consequences:

    • Reduced respiratory capacity

    • Altered carbon source utilization

    • Changes in energy homeostasis

Studies in yeast have shown that mutations affecting mitochondrial inheritance can have significant impacts on cellular aging and lifespan. For example, in Podospora anserina, disruption of mitochondrial dynamics genes affects lifespan, suggesting similar impacts might be observed with AIM-31 mutations in N. crassa .

How can protein-protein interaction studies identify AIM-31's functional partners?

To identify protein interaction partners of AIM-31, several complementary approaches can be employed:

1. Cross-linking Mass Spectrometry (XL-MS):

  • Apply chemical cross-linkers to intact mitochondria expressing tagged AIM-31

  • Isolate AIM-31 and cross-linked proteins using affinity purification

  • Identify interaction partners through mass spectrometry

  • This approach has been successfully used to map the protein interaction landscape of mitochondrial therapeutics

2. Co-immunoprecipitation:

  • Express epitope-tagged AIM-31 in N. crassa

  • Isolate mitochondria and solubilize with appropriate detergents

  • Perform immunoprecipitation with anti-tag antibodies

  • Identify co-precipitated proteins by mass spectrometry or Western blotting

3. Yeast Two-Hybrid Screening:

  • Use AIM-31 as bait to screen a N. crassa cDNA library

  • Validate potential interactions through secondary assays

  • Map interaction domains through deletion constructs

4. Proximity-dependent Biotin Identification (BioID):

  • Create a fusion of AIM-31 with a biotin ligase

  • Express in N. crassa to biotinylate proteins in close proximity

  • Purify biotinylated proteins and identify by mass spectrometry

These approaches should be complemented with functional validation studies, such as:

  • Co-localization of AIM-31 with identified partners

  • Phenotypic analysis of partner gene deletions

  • Genetic interaction studies to identify synthetic effects

Are there homologs of AIM-31 in other fungi and how conserved is this protein?

AIM-31 belongs to a family of proteins involved in mitochondrial inheritance that shows varying degrees of conservation across fungal species. Comparative genomic analysis can reveal the evolutionary relationships:

Conservation Across Fungal Species:

  • Ascomycetes:

    • Neurospora species (e.g., N. crassa, N. sitophila, N. tetrasperma) likely have highly conserved AIM-31 homologs

    • Other Sordariales members such as Gelasinospora spp., Podospora anserina, and Chaetomium globosum may contain recognizable homologs with conserved functional domains

  • More Distant Fungi:

    • Saccharomyces cerevisiae has functionally analogous proteins (Mmr1, Ypt11) though sequence homology may be limited

    • More distant fungi such as Fusarium graminearum and Magnaporthe grisea may lack clear homologs

To properly analyze the conservation of AIM-31, sequence alignment and phylogenetic analysis should be performed, focusing on conserved functional domains and regulatory elements.

Functional Conservation:
While sequence conservation may vary, functional conservation can be assessed through complementation studies. For example, determining whether AIM-31 from N. crassa can rescue mitochondrial inheritance defects in yeast mutants lacking Mmr1 or Ypt11 would provide insights into functional conservation.

How does AIM-31 function compare to mitochondrial inheritance proteins in other organisms?

Mitochondrial inheritance mechanisms show both similarities and differences across eukaryotic species:

Comparison with Yeast Mitochondrial Inheritance Proteins:

OrganismKey Inheritance ProteinsPrimary MechanismsCytoskeletal Involvement
N. crassaAIM-31Under investigationLikely actin-dependent
S. cerevisiaeMmr1, Ypt11, Myo2Actin-based transport, retention at bud tipActin
P. anserinaFZO1, DNM1 (fusion/fission)Balance of fusion/fission affects inheritanceActin and microtubules

In yeast, mitochondrial inheritance involves both transport along actin cables (facilitated by Myo2-Mmr1/Ypt11 interactions) and retention mechanisms at the bud tip. The volume of mitochondria inherited has been directly linked to mtDNA stability, with reduced inheritance volume correlating with increased petite frequency .

In filamentous fungi like N. crassa, mitochondrial movement along hyphae introduces additional complexity compared to budding yeast. The mechanisms may involve both actin and microtubule cytoskeletons, with proteins like AIM-31 potentially playing roles in both transport and distribution.

Studies have shown that mitochondrial dynamics (fusion/fission) proteins also affect inheritance. For example, in P. anserina, the GTPases that regulate mitochondrial morphology affect lifespan and mtDNA stability .

What is the relationship between AIM-31 and mitochondrial genome stability?

The connection between mitochondrial inheritance proteins like AIM-31 and mitochondrial genome stability represents an important area of research:

Potential Mechanisms:

  • Volume-Dependent mtDNA Maintenance:
    Recent research has established a striking inverse correlation between the volume of mitochondria inherited and mtDNA instability. Studies in yeast demonstrate that strains with reduced mitochondrial inheritance (like Δmmr1) show significantly increased frequencies of petite colonies (indicating mtDNA loss or mutation) .

  • Nucleoid Distribution:
    AIM-31 may influence the distribution of mitochondrial nucleoids during cell division. Research in yeast has shown that the number of nucleoids in daughter cells correlates with the volume of mitochondria inherited .

  • mtDNA Copy Number Regulation:
    While the number of nucleoids may remain constant in some mutants, the mtDNA copy number per nucleoid can vary. Proteins affecting mitochondrial inheritance can influence the number of mtDNA copies transmitted to daughter cells .

The relationship between mitochondrial inheritance and genome stability is supported by experimental evidence showing that increasing mtDNA copy number can partially rescue the petite frequency phenotype in mitochondrial inheritance mutants, even without restoring normal mitochondrial volume inheritance .

How might AIM-31 be involved in the retrograde response in Neurospora crassa?

The retrograde response is a signaling pathway from mitochondria to the nucleus that regulates nuclear gene expression in response to mitochondrial dysfunction. AIM-31 could potentially interface with this pathway:

Possible Roles in Retrograde Signaling:

  • Sensor of Mitochondrial Status:
    AIM-31 might directly or indirectly monitor mitochondrial health and transmit signals to the nucleus when inheritance is compromised.

  • Interaction with Retrograde Factors:
    In N. crassa, one aspect of the retrograde response can be studied by examining the induction of alternative oxidase, encoded by the nuclear aod-1 gene. This gene is induced when the standard cytochrome-mediated respiratory chain is inhibited .

  • Regulation of Nuclear Gene Expression:
    AIM-31 deficiency might affect the expression of nuclear-encoded mitochondrial proteins through retrograde signaling pathways.

Research has identified an alternative oxidase induction motif (AIM) in N. crassa consisting of two CGG repeats separated by 7 bp, which appears to be bound by transcription factors of the Zn(II)2Cys6 binuclear cluster family . Whether AIM-31 plays a role in this regulatory mechanism remains to be determined.

How does AIM-31 contribute to mitochondrial dynamics (fusion, fission, transport)?

Mitochondrial dynamics involves the coordinated processes of fusion, fission, and transport, which are critical for mitochondrial function and inheritance:

Potential Roles in Mitochondrial Dynamics:

  • Mitochondrial Transport:

    • AIM-31 may function in mitochondrial transport along the cytoskeleton

    • It could interact with motor proteins like kinesins or myosins

    • The protein might help anchor mitochondria at specific cellular locations

  • Interface with Fusion/Fission Machinery:

    • AIM-31 could interact with fusion proteins (homologs of Fzo1, Mgm1)

    • It might coordinate with fission proteins (homologs of Dnm1)

    • These interactions could ensure proper mitochondrial morphology during inheritance

  • Regulation of Dynamics Proteins:

    • AIM-31 might regulate the activity or localization of dynamics proteins

    • It could respond to cellular signals that modulate fusion/fission rates

Studies in other fungi have shown connections between mitochondrial inheritance and dynamics. For instance, in Podospora anserina, manipulation of fusion/fission dynamics affects lifespan . In N. crassa, the GTPases that regulate mitochondrial morphology are conserved and likely interact with inheritance machinery .

Research has identified mitofusin homologs in N. crassa, such as FZO1, which function in the fusion of mitochondrial outer membranes . Understanding how AIM-31 interfaces with these proteins could provide insights into the coordination of inheritance and dynamics.

What are the most promising approaches for studying AIM-31 in the context of aging and cellular stress?

The connection between mitochondrial inheritance, dynamics, and aging presents exciting opportunities for AIM-31 research:

Innovative Research Approaches:

  • Lifespan Studies with AIM-31 Variants:

    • Compare lifespan of wild-type, AIM-31 knockout, and AIM-31 overexpression strains

    • Assess impact of specific AIM-31 mutations on lifespan

    • Evaluate whether AIM-31 manipulation can extend lifespan under certain conditions

  • Stress Response Analyses:

    • Characterize AIM-31 expression and localization under various stressors (oxidative, thermal, nutrient)

    • Determine whether AIM-31 knockout strains show altered sensitivity to stressors

    • Investigate whether AIM-31 mediates adaptations to chronic stress

  • Integration with Aging Pathways:

    • Examine interactions between AIM-31 and known aging regulators

    • Study how AIM-31 function changes in aging cells

    • Investigate connections to nutrient sensing pathways

Research in fungi has already established connections between mitochondrial dynamics and aging. In P. anserina and S. cerevisiae, young cells harbor long filamentous mitochondria, while the percentage of cells with fragmented mitochondria increases with age . Mutations affecting mitochondrial fusion (Δmgm1 and Δfzo1) shorten lifespan in yeast, suggesting that proteins like AIM-31 that affect mitochondrial inheritance might similarly impact aging processes .

How can systems biology approaches enhance our understanding of AIM-31's role in the mitochondrial network?

Systems biology offers powerful frameworks for understanding complex biological processes like mitochondrial inheritance:

Systems Approaches for AIM-31 Research:

  • Network Analysis:

    • Construct protein-protein interaction networks centered on AIM-31

    • Identify functional modules and pathway connections

    • Map the relationship between inheritance and other mitochondrial functions

  • Multi-omics Integration:

    • Combine proteomics, transcriptomics, and metabolomics data from AIM-31 mutants

    • Identify molecular signatures associated with AIM-31 dysfunction

    • Discover compensatory mechanisms activated in response to AIM-31 loss

  • Computational Modeling:

    • Develop mathematical models of mitochondrial inheritance incorporating AIM-31

    • Simulate the effects of AIM-31 mutations on inheritance outcomes

    • Predict system-level consequences of AIM-31 perturbations

  • Genome-Scale Analysis:

    • Perform genome-wide screens for genetic interactions with AIM-31

    • Use metabolic models like the N. crassa iJDZ836 model to predict metabolic consequences

    • Apply limed-FBA (likelihood-based flux balance analysis) to predict effects on metabolic pathways

By combining these approaches, researchers can move beyond studying AIM-31 in isolation to understanding its role within the broader context of cellular function and mitochondrial homeostasis.

What cutting-edge technologies hold promise for elucidating AIM-31's molecular mechanisms?

Several emerging technologies offer new opportunities for understanding AIM-31 function:

Innovative Methodologies:

  • CRISPR-Based Approaches:

    • Use CRISPR interference/activation to modulate AIM-31 expression

    • Apply base editing for precise manipulation of AIM-31 sequence

    • Implement CRISPR screening to identify functional domains and interactors

  • Advanced Imaging Techniques:

    • Apply super-resolution microscopy to visualize AIM-31 within mitochondrial subcompartments

    • Use live-cell imaging to track mitochondrial movement in AIM-31 mutants

    • Implement correlative light and electron microscopy for structural context

  • Proximity Labeling Technologies:

    • Apply TurboID or miniTurbo for rapid proximity labeling

    • Identify transient interaction partners of AIM-31

    • Map the spatiotemporal dynamics of AIM-31 interactions

  • Structural Biology Approaches:

    • Determine AIM-31 structure using cryo-electron microscopy

    • Apply hydrogen-deuterium exchange mass spectrometry to map functional domains

    • Use molecular dynamics simulations to predict conformational changes

  • Conditional Degradation Systems:

    • Implement auxin-inducible degradation for temporal control of AIM-31

    • Enable spatiotemporal functional analysis similar to systems developed for UNC-31

    • Study acute versus chronic effects of AIM-31 loss

These technologies, particularly when combined, promise to provide unprecedented insights into AIM-31 function and its role in mitochondrial inheritance in Neurospora crassa.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.