Recombinant Neurospora crassa Assembly factor cbp-4 (cbp-4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Neurospora crassa Assembly Factor cbp-4

The recombinant Neurospora crassa assembly factor cbp-4 is a protein derived from the filamentous fungus Neurospora crassa. This protein is of interest due to its role in cellular assembly processes and its potential applications in biotechnology. Neurospora crassa is a model organism widely used in genetic and molecular biology research, known for its ease of genetic manipulation and robust growth characteristics .

Description of Recombinant cbp-4 Protein

The recombinant full-length Neurospora crassa assembly factor cbp-4 protein is a recombinant protein expressed in Escherichia coli (E. coli). It consists of 125 amino acids and is fused with an N-terminal His tag, facilitating its purification and detection . The His tag is a common tool in molecular biology for protein purification, allowing for efficient isolation of the protein using affinity chromatography.

Potential Biotechnological Applications

Neurospora crassa is recognized for its potential in biotechnology due to its ability to secrete large amounts of protein into the culture medium, which is advantageous for industrial-scale protein production . The recombinant cbp-4 protein, being part of this system, could be explored for applications in protein production or as a tool for studying cellular assembly mechanisms.

References

  1. Creative Biomart. Recombinant Full Length Neurospora crassa Assembly factor cbp-4(cbp-4) Protein (Q7SDU5) (1-125aa), fused to N-terminal His tag, was expressed in E. coli. [Accessed 2025].

  2. Census Bureau. CBP Differential Privacy Demonstration Tables. [Accessed 2024].

  3. PMC. Lessons from the Genome Sequence of Neurospora crassa. [Accessed 2004].

  4. PMC. Transcriptional Profiling of Cross Pathway Control in Neurospora crassa and Comparative Analysis of the Gcn4 and CPC1 Regulons. [Accessed 2007].

  5. ASM. Lessons from the Genome Sequence of Neurospora crassa. [Accessed 2004].

  6. OIG. Review of U.S. Customs and Border Protections Fiscal Year 2023. [Accessed 2024].

  7. Nature. Neurospora intermedia from a traditional fermented food enables... [Accessed 2024].

  8. Frontiers. Challenging old microbiological treasures for natural compound biosynthesis capacity. [Accessed 2024].

  9. PMC. The Ccr4-Not Protein Complex Regulates the Phase of the Neurospora Circadian Clock. [Accessed 2013].

  10. Census Bureau. CBP Tables. [Accessed 2024].

  11. PMC. Establishment of Neurospora crassa as a host for heterologous protein production using a human antibody fragment as a model product. [Accessed 2017].

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted based on your needs.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
cbp-4; 5C2.060; NCU03147; Assembly factor cbp-4; Cytochrome b mRNA-processing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
cbp-4
Target Protein Sequence
MAAKKPVNWWLWTKMLLGGAAICVGGPAFTYWLTPTDEELFQKYNPELQKRSLERRFERQ QEFDDFVTKLKEYSKSDKPIWTVQAEAEEKERQQRASVQKSLALADEVKARKEAMRREAG LPLEK
Uniprot No.

Target Background

Function
Essential for the assembly of ubiquinol-cytochrome c reductase. It directly influences the correct incorporation of the Rieske protein, core 4, core 5, and apocytochrome b.
Database Links

KEGG: ncr:NCU03147

Protein Families
CBP4 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.