Recombinant Neurospora crassa ATP synthase subunit 9, mitochondrial (oli)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your preferred format in your order notes and we will do our best to fulfill your requirement.
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your preferred format in your order notes and we will do our best to fulfill your requirement.
Lead Time
Delivery times may vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs by default. For dry ice shipping, please inform us in advance as additional fees will apply.
Note: All proteins are shipped with standard blue ice packs by default. For dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
oli; atp-9; atp9; prl-1; B13D24.340; NCU02250; ATP synthase subunit 9, mitochondrial; Lipid-binding protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
67-147
Protein Length
Full Length of Mature Protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
oli
Target Protein Sequence
YSSEIAQAMVEVSKNLGMGSAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILG
FAFVEAIGLFDLMVALMAKFT
Uniprot No.
Target Background
Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for ATP production from ADP in the presence of a proton gradient across the membrane. This gradient is generated by electron transport complexes within the respiratory chain. F-type ATPases comprise two structural domains: F(1), encompassing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are interconnected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis within the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism of the central stalk subunits. The F(0) domain incorporates a homomeric c-ring, likely composed of 10 subunits, which constitutes part of the complex rotary element.
Database Links
KEGG: ncr:NCU02250
Protein Families
ATPase C chain family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
