Recombinant Neurospora crassa ATP synthase subunit a (atp-6)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

The atp-6 gene encodes subunit a of the F₀ domain of ATP synthase, a hydrophobic protein integral to proton channel formation. Key features:

  • Gene Synonyms: oli2, NCM020, NCU16025

  • Functional Role: Forms part of the proton-conducting channel in F₀, interacting with the c-subunit ring to drive ATP synthesis .

  • Mitochondrial Import: Synthesized as a precursor with a 66-amino-acid presequence for mitochondrial targeting .

Biogenesis and Processing

  • Precursor Processing: The immature subunit a precursor (15 kDa) contains an N-terminal presequence rich in basic residues, enabling mitochondrial import .

  • Maturation: Requires Atp23, a metalloprotease that cleaves the presequence and facilitates assembly with subunit 9 (c-ring) .

    • Atp23’s dual role: Proteolytic activity (processing) and chaperone function (stabilizing subunit a during F₀ assembly) .

    • Atp10, another chaperone, cooperates with Atp23 to stabilize subunit a .

Subunit a in ATP Synthase Dimerization

  • Cross-Linking Studies: Cysteine 23 in subunit a’s first transmembrane helix forms disulfide bonds with adjacent monomers, indicating proximity in ATP synthase dimers .

  • Role in Membrane Curvature: Subunit a interactions contribute to cristae formation by stabilizing ATP synthase oligomers .

Proton Translocation Mechanism

  • Subunit a contains conserved arginine (aR159) and glutamate (cE59) residues critical for proton transport .

  • Key Residues:

    • aR159: Forms an electrostatic interaction with cE59 during proton shuttling.

    • aH5 Helix: Houses the proton pathway from the intermembrane space .

Research Applications

  • In Vitro Assembly Studies: Used to reconstitute F₀ domain activity in liposomes .

  • Disease Modeling: Mutations in human homolog MT-ATP6 cause neuropathies (e.g., NARP syndrome) and optic atrophy .

  • Structural Biology: Facilitates cryo-EM studies of ATP synthase dimer interfaces .

Associated Pathologies

Dysfunction of ATP synthase subunit a homologs is linked to:

  • Neuropathy, Ataxia, and Retinitis Pigmentosa (NARP): Caused by MT-ATP6 mutations affecting proton transport .

  • Leber Hereditary Optic Neuropathy (LHON): Associated with mitochondrial ATP synthase defects .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
atp-6; oli2; NCM020; NCU16025; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
15-261
Protein Length
Full Length of Mature Protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
atp-6
Target Protein Sequence
SPLNQFEIRDLLSIDALGNLHISITNIGFYLTIGAFFFLVINLLSINYNRLVSNSWSISQ ESLYATIHSIVTSQINPRNGQIYFPFIYTLFIFILINNLIGMVPYSFASTSHFVVTFALS FTIVLGATILGFQKHGLEFFSLLVPAGCPLALLPLLVLIEFISYLARNISLGLRLAANIL SGHMLLHILAGFTYNIMTSGIIFFFLGLIPLAFIIAFSGLELGIAFIQAQVFVVLTSGYI KDALDLH
Uniprot No.

Target Background

Function

Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using the proton gradient across the mitochondrial membrane, generated by the respiratory chain's electron transport complexes. F-type ATPases comprise two domains: F1, the extramembrane catalytic core, and F0, the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through the rotary mechanism of the central stalk subunits. A key component of the proton channel, this subunit likely plays a direct role in proton transmembrane translocation.

Database Links

KEGG: ncr:NCU16025

Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase subunit a (ATP-6) in Neurospora crassa?

ATP synthase subunit a (ATP-6) in Neurospora crassa is a critical component of the mitochondrial ATP synthase complex, specifically located in the membrane-embedded Fo domain. According to high-resolution structural studies, ATP-6 works with the c-ring (composed of subunit 9) to shuttle protons across the mitochondrial inner membrane . The proton movement through this channel is coupled to ATP synthesis in the matrix-oriented F1 catalytic domain.

ATP-6 is highly hydrophobic and spans the inner mitochondrial membrane multiple times. Unlike many other ATP synthase components, ATP-6 is encoded by mitochondrial DNA (mtDNA) rather than nuclear DNA . Together with subunit 8, ATP-6 forms part of the stator that prevents rotation of the entire complex while allowing the central rotor to turn during catalysis .

How is the expression of ATP-6 regulated in Neurospora crassa?

The expression of ATP-6 in Neurospora crassa is subject to complex regulatory mechanisms that ensure proper stoichiometry with other ATP synthase components. Research reveals that:

  • Transcriptional regulation: ATP6 and ATP8 are cotranscribed, producing bicistronic mRNAs .

  • Translational regulation: Translation of ATP-6 appears to be regulated by the F1 sector of ATP synthase, creating a feedback mechanism that balances the output of mitochondrially-encoded and nuclear-encoded subunits .

  • Assembly-dependent regulation: Translation of ATP-6 is enhanced in strains with specific defects in ATP-6 assembly, suggesting an assembly-dependent feedback loop .

This regulatory complexity ensures proper coordination between mitochondrial and nuclear gene expression, as ATP synthase is composed of subunits encoded by both genomes .

What techniques are commonly used to study recombinant ATP-6 in Neurospora crassa?

Several methodological approaches have proven effective for studying recombinant ATP-6:

Expression Systems:

  • Heterologous expression in E. coli (though this is challenging for mammalian ATP-6)

  • Neurospora crassa expression systems for functional studies

Analytical Techniques:

  • In vivo labeling with 35S methionine/cysteine for protein synthesis monitoring

  • Blue native electrophoresis (BNE) for isolation of ATP synthase complexes

  • Sucrose density gradient preparation to isolate mitochondrial ribosomes

  • Northern blotting and strand-specific RT-PCR to analyze ATP6 transcripts

Functional Assays:

  • Patch-clamp experiments with reconstituted ATP-6

  • Calcium-dependent channel activity measurements

  • ATP synthase activity assays under different conditions (synthesis vs. hydrolysis)

Genetic Approaches:

  • Gene replacement with reporter genes (e.g., ARG8) for expression studies

  • Site-directed mutagenesis to study structure-function relationships

How does ATP-6 contribute to the mitochondrial permeability transition pore (mPTP)?

Recent research has established a connection between ATP synthase and the mitochondrial permeability transition pore (mPTP), with ATP-6 playing a significant role:

  • Studies show that purified dimers of ATP synthase reconstituted into lipid bilayers can form a Ca²⁺-dependent channel resembling the mPTP .

  • This channel activity is inhibited by ATP synthase modulators like AMP-PNP (a non-hydrolyzable ATP analog) and Mg²⁺/ADP .

  • In the presence of Ca²⁺, certain compounds like benzodiazepine 423 (Bz-423) can trigger channel opening with currents typical of the mitochondrial megachannel .

  • The ADP/ATP carrier (AAC) forms a large Ca²⁺-dependent channel when reconstituted, exhibiting similar characteristics to the mPTP, including response to Ca²⁺, bongkrekate (BKA), and ADP .

These findings suggest that ATP-6, as part of the ATP synthase dimer, contributes to the formation of the mPTP, which is a key effector of cell death . This represents a significant advancement in understanding the role of ATP synthase beyond its canonical function in ATP production.

What are the effects of known ATP-6 mutations on ATP synthase function?

Mutations in ATP-6 can significantly impact ATP synthase function, with various consequences for cellular energy metabolism:

Pathogenic Effects of ATP-6 Mutations:

MutationOrganismFunctional EffectReference
G8697AHumanChanges conserved methionine to isoleucine, potentially altering protein structure
A8860GHumanT112A amino acid change in breast cancer patients
m.9205delTAHumanPrevents detection of shorter ATP6 mRNA transcript, affects translation
m.8611insCHumanProduces aberrant mitochondrial polypeptide
atp6-L173PYeastAffects assembly of ATP synthase

Research shows that:

  • Some mutations alter conserved amino acids, potentially affecting the structure and function of ATP-6 .

  • Certain mutations (e.g., m.9205delTA) can affect mRNA processing or stability, leading to translation defects .

  • ATP-6 mutations have been identified in various neurodegenerative diseases, including Multiple Sclerosis, Huntington's disease, and Spinocerebellar Ataxias, suggesting a role in neural disorder pathogenesis .

  • Mutations can disrupt ATP-6's role in proton transport, affecting the efficiency of ATP synthesis .

Understanding these mutation effects provides insights into both basic ATP synthase function and potential therapeutic approaches for mitochondrial diseases.

How does the assembly of ATP-6 into the ATP synthase complex occur?

The assembly of ATP-6 into the ATP synthase complex follows a specific pathway that is still being elucidated:

  • Evidence suggests ATP synthase assembly in yeast involves three distinct modules that converge at the final stage:

    • The c-ring module

    • The F1 module

    • The ATP6/ATP8 module with associated chaperones

  • In mammalian systems, ATP-6 and A6L (ATP8) appear to be added late in the assembly process, after the formation of the c-ring, binding of F1, and assembly of the stator arm .

  • The expression of ATP-6 is translationally regulated by the F1 sector, ensuring balanced output between nuclear-encoded and mitochondrially-encoded subunits .

  • The peripheral stalk is important for stability of the c-ring/F1 complex during assembly .

  • Subunit A6L (ATP8) provides a physical link between the proton channel and other peripheral stalk subunits .

This assembly process highlights the complex coordination required between nuclear and mitochondrial gene expression systems to build the functional ATP synthase complex.

What methodologies are most effective for studying ATP-6 translation regulation?

Several sophisticated approaches have proven effective for investigating ATP-6 translation regulation:

Gene Replacement Strategies:

  • Replacing ATP6 with reporter genes such as ARG8m (a version of nuclear ARG8 recoded for expression in mitochondria) allows monitoring of ATP6 expression through arginine-independent growth .

  • This approach helped establish that F1 components upregulate ATP6 translation, as mutations in F1 components (Δatp2, Δatp12) prevented expression of the ARG8 reporter from the ATP6 locus .

RNA Analysis:

  • Northern blotting to quantify ATP6 mRNAs, normalized to other transcripts (e.g., COX3) to correct for differences due to secondary mutations .

  • Poisoned primer extension assays provide single-nucleotide resolution of ATP6 mRNAs .

  • Strand-specific reverse transcription followed by semi-quantitative PCR can identify which transcripts associate with ribosomes .

Ribosome Association Studies:

  • Sucrose density gradient preparation to isolate mitochondrial ribosomes .

  • Analysis of which ATP6 transcripts associate with monosomes vs. lighter fractions .

In vivo Translation Monitoring:

  • Metabolic labeling with 35S methionine/cysteine followed by protein separation and autoradiography to monitor newly synthesized proteins .

  • siRNA knockdown of factors like OXA1L and AFG3L2 to study their effects on ATP6 translation and stability .

These methodologies have revealed that ATP6 translation involves complex regulatory mechanisms, including assembly-dependent feedback and co-translational quality control.

How does the import and processing of Neurospora crassa ATP synthase components differ from other organisms?

The import and processing of Neurospora crassa ATP synthase components show distinctive features compared to other organisms:

  • The proteolipid subunit (ATP synthase subunit 9) is synthesized in Neurospora crassa as a precursor with an unusually long presequence of 66 amino acids .

  • This presequence is highly polar (containing 12 basic and no acidic side chains), contrasting sharply with the extremely hydrophobic mature proteolipid of 81 amino acids .

  • The presequence appears specifically designed to solubilize the hydrophobic proteolipid for post-translational import into mitochondria .

  • Unlike in yeast and mammals where the corresponding subunit is mitochondrially encoded, in Neurospora crassa, ATP synthase subunit 9 is nuclear-encoded but still imported into mitochondria .

  • The precursor form has a molecular weight of approximately 15,000 Da before processing to the mature form .

This unique import mechanism demonstrates evolutionary adaptation to handle extremely hydrophobic proteins and represents an interesting case of gene transfer from mitochondrial to nuclear DNA compared to other organisms.

What is the role of cyclophilin D in regulating ATP-6 function in the mitochondrial permeability transition?

Cyclophilin D (CyPD) plays a significant regulatory role in ATP-6 function, particularly relating to the mitochondrial permeability transition pore:

  • CyPD binds to the lateral stalk of ATP synthase, specifically to the oligomycin sensitivity-conferring protein (OSCP) subunit .

  • When isolated from Neurospora crassa, cyclophilin suppresses voltage gating of the Ca²⁺-dependent channel formed by the ADP/ATP carrier, increasing conductivity at high positive voltage .

  • This effect of cyclophilin can be abolished by cyclosporin A (CsA), a cyclophilin inhibitor .

  • ATP synthase dimers reconstituted into lipid bilayers form Ca²⁺-dependent channels that can be triggered by compounds like Bz-423, which binds to the same site on OSCP as cyclophilin D .

  • Pro-oxidants like tert-butyl hydroperoxide can reversibly suppress voltage gating of the channel, similar to cyclophilin's effect .

These findings suggest a complex regulatory mechanism where cyclophilin D modulates ATP-6 function in relation to permeability transition, potentially linking ATP synthase activity to cell death pathways through regulation of the mPTP.

What experimental approaches can be used to study the structure-function relationship of recombinant ATP-6?

Several sophisticated experimental approaches can be employed to investigate structure-function relationships in recombinant ATP-6:

Site-Directed Mutagenesis:

  • Creating specific mutations in conserved residues of ATP-6 to assess their functional importance

  • Analyzing the effects of disease-associated mutations on ATP synthase assembly and function

  • Introducing mutations that alter proton conductance to study the mechanism of proton transport

Reconstitution Studies:

  • Reconstituting purified ATP synthase components into lipid bilayers for functional studies

  • Patch-clamp experiments to measure channel-forming properties of ATP-6

  • Analysis of Ca²⁺-dependent channel activity with various modulators

Structural Analysis:

  • Cryo-electron microscopy to visualize ATP-6 in the context of the ATP synthase complex

  • Crosslinking studies to identify interaction partners

  • Proteolytic mapping to define membrane topology

In vivo Expression:

  • Gene replacement strategies using reporter genes like ARG8m

  • Expression of ATP-6 variants in cells lacking endogenous ATP-6

  • Complementation studies to assess functional rescue

Assembly Analysis:

  • Blue native electrophoresis to isolate ATP synthase complexes at various assembly stages

  • Pulse-chase experiments to track ATP-6 incorporation into complexes

  • Co-immunoprecipitation to identify assembly factors

These approaches provide complementary data on how ATP-6 structure relates to its various functions in ATP synthesis and potentially in mitochondrial permeability transition.

How can researchers overcome challenges in expressing recombinant Neurospora crassa ATP-6?

Expressing recombinant Neurospora crassa ATP-6 presents several challenges due to its hydrophobicity and mitochondrial origin. Researchers can address these challenges through:

Expression System Selection:

  • Neurospora crassa ATP-6 has been successfully expressed in E. coli, whereas mammalian ATP-6 cannot be expressed in this system . This makes N. crassa a valuable model.

  • The recombinant ATP synthase from N. crassa expressed in E. coli is free from residual mitochondrial components that might associate with ATP synthase in preparations from native sources .

Protein Solubilization:

  • Use appropriate detergents for membrane protein solubilization (digitonin has been effective for ATP synthase complexes) .

  • Consider fusion tags that enhance solubility while maintaining function.

  • Employ amphipathic environments that mimic the native membrane.

Functional Reconstitution:

  • Reconstitute the purified protein into liposomes or nanodiscs for functional studies.

  • For channel activity studies, incorporate the protein into planar lipid bilayers for patch-clamp analysis .

Quality Control:

  • Verify proper folding through limited proteolysis or circular dichroism.

  • Assess functionality through ATP synthesis assays or channel activity measurements.

  • Confirm proper assembly using native gel electrophoresis.

Co-expression Strategies:

  • Consider co-expressing ATP-6 with interacting partners to stabilize the protein.

  • The ATP8/ATP6 module might need to be expressed together for proper stability .

By implementing these strategies, researchers can overcome the inherent difficulties in expressing this hydrophobic mitochondrial protein while maintaining its native characteristics for accurate functional studies.

What analytical techniques are most appropriate for characterizing ATP-6 interactions with other subunits?

Several advanced analytical techniques can effectively characterize ATP-6 interactions with other ATP synthase subunits:

Crosslinking Coupled with Mass Spectrometry:

  • Chemical crosslinking can capture transient interactions between ATP-6 and other subunits

  • Mass spectrometry analysis of crosslinked peptides identifies specific interaction sites

  • Zero-length crosslinkers can determine proteins in direct contact

Blue Native Electrophoresis (BNE):

  • Isolates intact ATP synthase complexes and subcomplexes

  • Combined with second-dimension SDS-PAGE to identify subunit composition

  • Can track assembly intermediates containing ATP-6

Co-immunoprecipitation:

  • Using antibodies against ATP-6 or other subunits to isolate protein complexes

  • Western blotting to identify co-precipitated proteins

  • Can be performed under different conditions to assess interaction stability

Surface Plasmon Resonance:

  • Real-time measurement of binding kinetics between ATP-6 and other purified subunits

  • Determines association and dissociation rates

  • Quantifies binding affinities

Cryo-Electron Microscopy:

  • Visualizes ATP-6 in the context of the entire ATP synthase complex

  • Provides structural information about subunit arrangements

  • Can reveal conformational changes upon binding

Fluorescence Resonance Energy Transfer (FRET):

  • Labels ATP-6 and potential interaction partners with appropriate fluorophores

  • Measures energy transfer as an indication of protein proximity

  • Can be performed in live cells to study dynamic interactions

These techniques offer complementary information about how ATP-6 interacts with other subunits during both assembly and function of the ATP synthase complex.

How can researchers investigate the relationship between ATP-6 and mitochondrial permeability transition?

Investigating the relationship between ATP-6 and mitochondrial permeability transition (mPT) requires specialized techniques:

Reconstitution Studies:

  • Purify ATP synthase dimers using blue native electrophoresis (BNE) .

  • Reconstitute the purified dimers into planar lipid bilayers .

  • Record channel activity in the presence of Ca²⁺ and ATP synthase modulators .

  • Compare channel characteristics with those of the native mPT pore.

Site-Directed Mutagenesis:

  • Introduce mutations in ATP-6 that may affect mPT function.

  • Express mutated ATP-6 in appropriate systems.

  • Assess the effect on Ca²⁺-induced permeability transition.

Pharmacological Approaches:

  • Test known mPT modulators (cyclosporin A, bongkrekate, ADP) on reconstituted ATP-6 .

  • Examine the effect of ATP synthase inhibitors like oligomycin or benzodiazepine 423 .

  • Investigate pro-oxidant effects (e.g., tert-butyl hydroperoxide) on channel activity .

ATP Synthase Activity Correlation:

  • Manipulate ATP synthase between synthesis and hydrolysis modes .

  • Measure Ca²⁺ tolerance under different functional states .

  • Correlate ATP synthase conformation with mPT susceptibility.

Genetic Approaches:

  • Modify expression of ATP-6 or other components like cyclophilin D.

  • Assess changes in mPT sensitivity in response to Ca²⁺ overload.

  • Use reporter systems to track mPT opening in response to various stimuli.

These methodologies have revealed that ATP synthase dimers can form a channel with properties similar to the mPT pore, suggesting that ATP-6, as part of this complex, plays a role in this critical cell death mechanism .

What are the emerging areas of research involving Neurospora crassa ATP-6?

Recent research involving Neurospora crassa ATP-6 has expanded into several exciting directions:

  • Mitochondrial Permeability Transition Studies:

    • Using N. crassa ATP synthase components to study mPT mechanisms

    • Investigating how ATP-6 contributes to channel formation in ATP synthase dimers

    • Exploring the relationship between ATP synthase conformation and mPT sensitivity

  • Translation Regulation Mechanisms:

    • Understanding assembly-dependent translation of ATP-6

    • Exploring the role of specialized translation activators (e.g., ATP22 in yeast)

    • Investigating co-translational quality control mechanisms

  • Evolutionary Studies:

    • Comparative analysis of ATP-6 structure and function across species

    • Understanding the unique import mechanisms for ATP synthase components in N. crassa

    • Exploring gene transfer events between mitochondrial and nuclear genomes

  • Disease Model Applications:

    • Using N. crassa as a model to study disease-associated ATP-6 mutations

    • Investigating the role of ATP-6 in neurodegenerative disease mechanisms

    • Developing therapeutic approaches for mitochondrial diseases

  • Structural Biology Advancements:

    • High-resolution structural studies of ATP synthase components

    • Mapping the precise location of ATP-6 within the ATP synthase complex

    • Understanding the conformational changes associated with ATP synthase function

These emerging areas demonstrate the continued relevance of N. crassa as a model organism for understanding fundamental aspects of mitochondrial biology and energy metabolism.

How do recent findings about ATP-6 revise our understanding of ATP synthase assembly?

Recent discoveries have significantly revised our understanding of ATP synthase assembly, particularly regarding ATP-6:

  • Multiple Assembly Pathways:

    • Research now indicates that ATP synthase assembly involves three separate modules (F1, c-ring, and ATP6/ATP8) that converge at the end stage, rather than a strictly sequential process .

    • This modular assembly model differs from earlier linear models of ATP synthase assembly.

  • Assembly-Dependent Translation:

    • Studies show that translation of ATP-6 and ATP-8 is enhanced in strains with specific defects in assembly, suggesting a feedback mechanism different from previously proposed models .

    • This contradicts the view that ATP-6 translation is simply controlled by F1 components in a unidirectional manner.

  • C-ring Assembly Integration:

    • Recent findings challenge the generally accepted view that the subunit 9 (c-ring) forms separately, independently of other ATP synthase components .

    • The data suggest more integrated assembly coordination than previously recognized.

  • Transcript Utilization:

    • Research shows the longer tricistronic mRNA containing ATP8/6/CO3 is the predominant transcript associated with mitochondrial ribosomes, revising our understanding of how ATP-6 is translated .

    • This contradicts previous assumptions about which transcripts serve as templates for translation.

  • Dual Role of ATP Synthase:

    • The discovery that ATP synthase dimers can form the mitochondrial permeability transition pore establishes a dual role for this complex beyond ATP production .

    • This suggests assembly may need to accommodate both functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.