Recombinant Neurospora crassa Bifunctional lycopene cyclase/phytoene synthase (al-2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
al-2; B22I21.230; NCU00585; Bifunctional lycopene cyclase/phytoene synthase; Protein albino-2 [Includes: Lycopene beta-cyclase; Carotene cyclase; Lycopene cyclase; Phytoene synthase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-602
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
al-2
Target Protein Sequence
MYDYAFVHLKFTVPAAVLLTAIAYPILNRIHLIQTGFLVVVAFTAALPWDAYLIKHKVWS YPPEAIVGPRLLGIPFEELFFFVIQTYITALVYILFNKPVLHALHLNNQQNPPAWMRVVK VTGQVVLVALSVWGWNAAQVHQETSYLGLILVWACPFLLAIWTLAGRFILSLPWYATVLP MFLPTFYLWAVDEFALHRGTWSIGSGTKLDFCLFGKLDIEEATFFLVTNMLIVGGMAAFD QYLAVIYAFPTLFPKVNRYPTTHMLLQSRLINTSRYDLERIEGLREAVERLRLKSRSFYL ANSLFSGRLRIDLILLYSFCRLADDLVDDAKSRREVLSWTAKLNHFLDLHYKDADATEDP KKKAERIDAYIKTAFPPCAYQALHLLPTHILPPKPLYDLIKGFEMDSQFTFHGTSDSTDL QYPIADDKDLENYAIYVAGTVGELCIALIIYHCLPDMSDTQKRELETAACRMGIALQYVN IARDIVVDARIGRVYLPTTWLKKEGLTHKMVLENPEGPEVIERMRRRLLENAFELYGGAR PEMQRIPSEARGPMIGAVENYMAIGRVLRERKEGTVFVRMEGRATVPKRRRLSTLLRALY EQ
Uniprot No.

Target Background

Function
This bifunctional enzyme catalyzes reactions from geranylgeranyl diphosphate to phytoene (phytoene synthase), from lycopene to beta-carotene via the intermediate gamma-carotene, and from 3,4-didehydrolycopene to torulene (lycopene cyclase). Torulene is further processed to the acidic carotenoid neurosporaxanthin. The cyclase preferentially catalyzes single cyclizations at only one end of the substrate, resulting in the production of monocyclic carotenoids.
Database Links

KEGG: ncr:NCU00585

Protein Families
Lycopene beta-cyclase family; Phytoene/squalene synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the al-2 gene in Neurospora crassa and what is its role in carotenoid biosynthesis?

The al-2 gene in Neurospora crassa encodes a bifunctional enzyme that catalyzes two key reactions in the carotenoid biosynthetic pathway. The enzyme mediates both the formation of phytoene from geranylgeranyl pyrophosphate (GGPP) through its phytoene synthase (PS) activity and the introduction of β-cycles in desaturated carotenoid products through its lycopene cyclase activity . These activities are essential for the production of the xanthophyll neurosporaxanthin and its precursor carotenoids, which give N. crassa its characteristic orange pigmentation .

The bifunctional nature of AL-2 was not initially obvious to researchers. Early studies identified only its phytoene synthase activity, with the cyclase function being discovered later after similar findings in the orthologous CrtYB protein in Xanthophyllomyces dendrorhous suggested that AL-2 might also possess cyclase functionality . This dual functionality in a single protein represents an evolutionary distinction between fungi and other organisms like plants and bacteria, where these enzymatic activities are encoded by separate genes.

  • How is the bifunctional enzyme structurally organized to support its dual activities?

The AL-2 protein in N. crassa, like its orthologs in other fungi, possesses a distinctive domain organization that enables its bifunctional activity. Based on studies of similar enzymes in other fungi, the protein contains two functionally distinct domains :

  • The N-terminal domain is highly hydrophobic and contains the lycopene cyclase activity

  • The C-terminal domain is more hydrophilic and contains the phytoene synthase activity

This domain arrangement is consistent with the organization observed in orthologous proteins such as CrtYB in X. dendrorhous and the CarRP gene product in Mucor circinelloides . Functional studies with CarRP have revealed interesting domain interdependencies, where "the R domain is functional even in the absence of the P domain, while the latter needs the proper R domain conformation to carry out its function" . This suggests complex allosteric relationships between the domains that may also be present in AL-2.

The unique bifunctional arrangement found in fungi contrasts with plants and bacteria, where separate genes encode these activities . This structural conservation across fungal species suggests an evolutionary advantage to this arrangement in fungi, possibly related to coordinated regulation of these sequential enzymatic steps in carotenoid biosynthesis.

  • What phenotypes result from different mutations in the al-2 gene?

Mutations in the al-2 gene of N. crassa result in distinct phenotypes depending on which functional domain is affected and the nature of the mutation. While specific details of all al-2 mutations are not provided in the search results, we can infer phenotypic outcomes based on the bifunctional nature of the enzyme and comparative data from similar fungi :

Mutation TypeAffected DomainExpected PhenotypeMolecular Consequence
Complete loss-of-functionBoth domainsAlbino/whiteNo carotenoid synthesis
N-terminal domain specificCyclase onlyRed pigmentationLycopene accumulation
C-terminal domain specificPhytoene synthase onlyAlbino/whiteNo phytoene formation
Partial activity mutationsEither domainAltered pigmentationReduced carotenoid synthesis

The red pigmentation phenotype resulting from cyclase-deficient mutations has been observed in other fungi like zygomycetes, where "cyclase deficient mutants of zygomycetes exhibit a red pigmentation due to the accumulation of lycopene, distinguishing them from β-carotene-accumulating, yellow wild type" .

Search result mentions the sequence determination of nine al-2 mutations, indicating that multiple phenotypic variants have been characterized, although specific details of each mutant phenotype aren't provided in the search results.

  • How does the regulation of al-2 compare to similar carotenogenic genes in other fungi?

While the search results don't provide specific information about al-2 regulation in N. crassa, we can draw parallels from related genes in other fungi, particularly the carRP gene in Mucor circinelloides described in search result . These comparative insights suggest several regulatory mechanisms that may apply to al-2:

Light-Dependent Regulation:
In M. circinelloides, carRP and the adjacent phytoene dehydrogenase gene (carB) show coordinated regulation by blue light. Northern analyses revealed "a co-ordinated regulation of the expression of both genes by blue light" . Given the functional similarity between carRP and al-2, it's reasonable to hypothesize that al-2 in N. crassa might also be regulated by light, particularly blue light.

Promoter Organization:
For carRP in M. circinelloides, "the promoter regions of both genes [carRP and carB] are located within only 446 bp" and there are "several motifs found in this promoter region [that] suggest a bi-directional mode of transcription control" . This compact, potentially bidirectional promoter arrangement might also be present for al-2 in N. crassa, especially if it is located near other carotenoid biosynthesis genes.

The regulatory patterns of carotenogenic genes appear to be conserved across fungal species, likely reflecting the importance of coordinated expression for efficient carotenoid biosynthesis. This coordination ensures appropriate stoichiometry of pathway enzymes and allows for collective response to environmental stimuli such as light exposure.

Advanced Research Questions

  • How do recombination regulatory genes affect the al-2 locus in N. crassa?

Recombination at specific loci in Neurospora crassa, including potentially the al-2 locus, is influenced by specialized regulatory genes such as rec-1, rec-2, and rec-3. Recent research has significantly revised our understanding of how these genes function . While the search results don't directly address the interaction between rec genes and al-2, we can infer potential relationships based on established mechanisms:

Recombination GeneTraditional UnderstandingUpdated MechanismEffect on Target Loci
rec-1Dominant suppression of recombinationMeiotic silencing of recessive alleleRegion-specific reduction in recombination
rec-2Dominant suppression of recombinationMeiotic silencing of recessive alleleRegion-specific reduction in recombination
rec-3Reduces recombination at am-1 locusMeiotic silencing of recessive alleleLocus-specific reduction in recombination

Search result provides a crucial update to our understanding, revealing that "for all 3 known rec genes, 1 allele appears dominant only because meiotic silencing prevents the product of the active, 'recessive,' allele from stimulating recombination during meiosis." This silencing effect is mediated by the sad-1 gene, which encodes an RNA-dependent RNA polymerase that silences unpaired coding regions during meiosis .

When sad-1 is mutated in crosses heterozygous for rec alleles, recombination increases in the target regions, indicating that the apparent dominant suppression is actually due to silencing of genes that promote recombination . This mechanism likely extends to the al-2 locus if it falls within a region regulated by one of these rec genes.

  • What methods are most effective for creating targeted modifications of the al-2 gene?

Creating targeted modifications of the al-2 gene in Neurospora crassa requires specialized approaches due to the historically low rates of homologous recombination in filamentous fungi. Based on search result , several methodological strategies have proven effective:

High-Throughput Gene Knockout Procedure:
The method described in search result combines yeast recombinational cloning with split-marker transformation techniques. This approach yielded significantly improved results, with "on average, 44% of the transformants obtained with this strategy had the proper integration" . This procedure can be adapted specifically for al-2 modifications by:

  • Designing flanking primers that target precise regions of the al-2 gene

  • Creating knockout cassettes through yeast recombinational cloning

  • Amplifying the fragments by PCR from pooled yeast DNA

  • Cotransforming these fragments into Neurospora

For domain-specific studies of AL-2, researchers can design constructs that selectively modify either the N-terminal cyclase domain or the C-terminal phytoene synthase domain, allowing independent investigation of each function.

Screening Considerations:
The distinctive pigmentation phenotypes associated with al-2 mutations provide a valuable visual screening method that can facilitate identification of successful transformants. Different phenotypes can be expected depending on which domain is affected:

  • Mutations affecting both domains: albino phenotype

  • Cyclase domain mutations: potential red pigmentation due to lycopene accumulation

  • Phytoene synthase domain mutations: albino phenotype

Verification of modifications should include both phenotypic analysis and molecular confirmation through PCR and sequencing.

  • What analytical methods are most effective for characterizing carotenoid profiles in al-2 mutants?

Comprehensive characterization of carotenoid profiles in al-2 mutants requires a multi-faceted analytical approach combining extraction, separation, identification, and quantification techniques. Based on standard practices in carotenoid research, the following methodological framework is recommended:

Analytical StageTechniquesKey ParametersApplications for al-2 Research
ExtractionOrganic solvent extractionSolvent selection (acetone, hexane, chloroform)Efficient recovery of all carotenoid classes
SaponificationAlkaline treatment conditionsRemoval of interfering lipids
SeparationHPLC/UPLCColumn selection (C18, C30)Resolution of carotenoid isomers
Mobile phase gradientsSeparation based on polarity
DetectionUV-Vis spectroscopyCharacteristic absorption maximaIdentification of specific carotenoids
Mass spectrometryAPCI or ESI ionizationStructural confirmation
QuantificationExternal standard methodStandard curvesAbsolute quantification
Internal standard methodDeuterated standardsCorrection for extraction losses

For al-2 mutants with specific functional defects, targeted analysis should focus on:

  • Cyclase-deficient mutants: Detection and quantification of lycopene accumulation

  • Synthase-deficient mutants: Verification of phytoene absence and downstream carotenoid depletion

  • Partial function mutants: Complete profiling to detect altered pathway intermediates

Data interpretation should include comparison with wild-type profiles to identify specific biosynthetic blocks resulting from the mutations. This comprehensive approach enables researchers to correlate genetic modifications with precise biochemical consequences in the carotenoid pathway.

  • How can domain-specific functions of AL-2 be experimentally separated and characterized?

The bifunctional nature of AL-2, with distinct cyclase and synthase activities in separate domains, presents both challenges and opportunities for experimental investigation. Based on information from search results and , several strategies can effectively separate and characterize these functions:

Domain-Specific Mutagenesis:
Create targeted mutations in either the N-terminal cyclase domain or C-terminal synthase domain while preserving the other function. This approach can utilize:

  • Site-directed mutagenesis of conserved catalytic residues

  • Domain truncation experiments to express individual domains

  • Chimeric proteins combining domains from different fungal species

Heterologous Expression Systems:
Express recombinant versions of either full-length AL-2 or individual domains in suitable expression systems:

  • Bacterial expression (E. coli) may work for individual domains

  • Yeast expression systems might better accommodate the full-length protein

  • Baculovirus-insect cell systems for difficult-to-express proteins

From search result , we know that in the related CarRP protein from M. circinelloides, "the R domain is functional even in the absence of the P domain, while the latter needs the proper R domain conformation to carry out its function." This suggests that expressing the N-terminal domain alone might retain cyclase activity, while the C-terminal domain might require structural elements from the N-terminal region to function properly.

Assay Development:
Develop separate biochemical assays for each enzymatic activity:

  • Cyclase activity: Measure conversion of lycopene to β-carotene

  • Synthase activity: Measure formation of phytoene from GGPP

This experimental framework allows systematic investigation of how the two enzymatic activities cooperate within the bifunctional enzyme and provides insights into the evolutionary advantages of this arrangement in fungi.

  • What biosafety considerations apply to research with recombinant N. crassa strains containing modified al-2?

Research involving recombinant N. crassa strains with modified al-2 requires careful attention to biosafety considerations, as outlined in search results and . The following framework addresses key aspects of biosafety management for this research:

Regulatory Framework:
"This policy applies to all persons who perform research involving recombinant DNA molecules" . Institutional Biosafety Committees (IBCs) must review recombinant DNA activities for compliance with NIH Guidelines, including:

  • Independent assessment of required containment levels

  • Evaluation of facilities, procedures, and personnel expertise

  • Implementation of surveillance and reporting measures

  • Ensuring research does not involve prohibited activities

Containment Strategies:
For recombinant N. crassa work, multiple containment approaches should be implemented:

  • Physical Containment:
    Appropriate Biosafety Level facilities (typically BSL-1 for non-pathogenic N. crassa)

  • Biological Containment:
    "Experiments involving recombinant DNA lend themselves to a third containment mechanism, namely, the application of highly specific biological barriers" . These include:

    • Natural barriers limiting infectivity or environmental dissemination

    • Genetically designed vectors with reduced probability of dissemination

    • Use of laboratory strains with reduced viability outside controlled conditions

Risk Assessment:
When modifying the al-2 gene, researchers should evaluate:

  • Whether modifications could alter pathogenicity or host range

  • Potential ecological impacts if the recombinant strain were released

  • Whether novel metabolites with unknown properties might be produced

For most research involving al-2 modifications focused on carotenoid biosynthesis, these would generally be considered low-risk activities, but formal assessment and documentation remain essential regulatory requirements.

  • How does meiotic silencing affect recombination at the al-2 locus?

Recent research has revealed that meiotic silencing plays a crucial role in regulating recombination at specific loci in Neurospora crassa. Search result provides important insights into this mechanism that likely extends to the al-2 locus:

Meiotic Silencing Mechanism:
"When sad-1 (an RNA-dependent RNA polymerase that silences unpaired coding regions during meiosis) is introduced into crosses heterozygous rec-2SL/rec-2LG, it increased recombination, indicating that meiotic silencing of a gene promoting recombination is responsible for dominant suppression of recombination" . This reveals that:

  • Heterozygosity at recombination regulatory loci triggers meiotic silencing

  • This silencing prevents expression of genes that promote recombination

  • The apparent "dominant" suppression of recombination is actually due to this silencing mechanism

Genetic ConfigurationSad-1 StatusExpected Recombination at Target Loci
Homozygous rec+Active or InactiveHigher recombination rates
Homozygous recActive or InactiveLower baseline recombination
Heterozygous rec+/recActive SAD-1Lower recombination (silencing occurs)
Heterozygous rec+/recMutant sad-1Higher recombination (no silencing)

Implications for al-2 Research:
If al-2 falls within a chromosomal region regulated by rec genes, then:

  • Crosses between strains with different rec alleles would show altered recombination frequencies at the al-2 locus

  • Introducing a sad-1 mutation would likely increase recombination at al-2 in heterozygous crosses by preventing meiotic silencing

  • This could be exploited experimentally to increase the efficiency of recombination-based genetic manipulations at the al-2 locus

Search result concludes that "for all 3 known rec genes, 1 allele appears dominant only because meiotic silencing prevents the product of the active, 'recessive,' allele from stimulating recombination during meiosis." This fundamental revision of our understanding has significant implications for genetic manipulation strategies targeting al-2.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.