Recombinant Neurospora crassa C-8 sterol isomerase (erg-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
erg-1; 9G6.010; NCU04156; C-8 sterol isomerase; Delta-8--delta-7 sterol isomerase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-256
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
erg-1
Target Protein Sequence
MPPKKQSSSGGNKPSGSGSSSGRSSSGSSCRCSCRCRCSIGGWLKFFAILFALVAPIAYV LEQRLESFYVFDTEHLHDLSKRAISAHGNDTKAIVKYIVDELNDRNGVAPYVNNDEEWVF NNAGGAMGAMYIIHASITEYLIIFGTAIGTEGHTGRHTADDYFHILTGTQTAYVPGEYEP EVYPPGSVHHLVRGTVKQYRMPESCFALEYARGWIPPMLFFGYADTLSSTLDFPTLWRTS VITGREMISNLLKGKF
Uniprot No.

Target Background

Function
Catalyzes the C-7 unsaturation reaction in the B ring of sterols.
Database Links

KEGG: ncr:NCU04156

Protein Families
ERG2 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the function of Neurospora crassa C-8 Sterol Isomerase (erg-1)?

Neurospora crassa C-8 Sterol Isomerase (erg-1) functions as a critical enzyme in the ergosterol biosynthesis pathway. It catalyzes the isomerization of the double bond between positions C-8 and C-9 to positions C-7 and C-8 of the sterol ring system. The enzyme is homologous to Erg2 of Saccharomyces cerevisiae and plays an essential role in maintaining proper sterol structure in fungal cell membranes. This isomerization step is crucial for the formation of ergosterol, which serves as the primary sterol component in fungal membranes and influences multiple cellular processes including growth, development, and membrane fusion .

How does erg-1 function in the ergosterol biosynthesis pathway?

Erg-1 occupies a specific position in the multi-step ergosterol biosynthesis pathway where it catalyzes a critical isomerization reaction. In this pathway, erg-1 acts downstream of the initial cyclization reactions that form the sterol core structure. The enzyme specifically contributes to forming the characteristic double bond arrangement in the B ring of the sterol structure. When erg-1 is absent or non-functional, the pathway becomes blocked at this isomerization step, resulting in the accumulation of sterol intermediates with altered double bond arrangements—specifically, sterols containing a double bond between positions C-8 and C-9 instead of the proper C-7 and C-8 positions found in ergosterol .

What structural features characterize the sterol intermediates in erg-1 mutants?

Gas chromatography/mass spectrometry (GC/MS) analysis has revealed that erg-1 mutants accumulate primarily three sterol intermediates with distinct structural characteristics:

Sterol IntermediateDouble Bond PositionsKey Structural Differences from Ergosterol
Ergosta-8,22-dienolC-8/C-9 and C-22/C-23Lacks C-5/C-6 double bond; C-8/C-9 instead of C-7/C-8
FecosterolC-8/C-9Lacks C-5/C-6 double bond; C-8/C-9 instead of C-7/C-8
Third intermediate*C-8/C-9Double bond between C-8/C-9 instead of C-7/C-8

*Specific name not provided in the research data.

These structural alterations in the sterol ring system are responsible for the phenotypic abnormalities observed in erg-1 mutants, including developmental defects and impaired membrane fusion .

What phenotypic characteristics are associated with erg-1 mutations?

Mutations in erg-1 lead to several distinct phenotypic characteristics that can be observed at both macroscopic and microscopic levels:

Phenotypic LevelCharacteristics in erg-1 Mutants
MacroscopicCharacteristic pigment production; delayed growth and development
MicroscopicMembrane invaginations at cell-to-cell contact zones; reduced plasma membrane fusion (~50% reduction compared to wild-type)
CellularAccumulation of altered sterol intermediates; normal germling interaction frequency (81.7 ± 0.9%, comparable to wild-type)
DevelopmentalSignificant delays in growth and development; mycelia exhibit specific developmental defects

These phenotypic characteristics directly result from the altered sterol composition caused by the erg-1 mutation, highlighting the importance of proper sterol structure for normal fungal growth and development .

How do erg-1 mutations specifically impact plasma membrane fusion mechanisms?

The relationship between erg-1 mutations and plasma membrane fusion represents a fascinating area of research that reveals structure-function relationships in biological membranes. When erg-1 is deleted or mutated, plasma membrane fusion during the interaction of vegetative spore germlings becomes specifically impaired. While the frequency of initial interactions between Δerg-1 germlings remains comparable to wild-type (81.7 ± 0.9%), the fusion frequency is dramatically reduced by approximately 50% .

Microscopically, cell pairs of Δerg-1 mutants typically form characteristic membrane invaginations after physical contact, rather than successfully completing membrane merger. These invaginations represent arrested fusion intermediates that cannot progress to complete fusion. The specific structural changes in sterols—particularly the altered double bond arrangement in the B ring—appear to modify physical properties of the plasma membrane that are essential for the complex process of membrane merger .

Interestingly, knockout studies have shown that the fusion defect caused by erg-1 mutation is independent of the fusion protein PRM1, as a Δerg-1/ΔPrm1 double mutant shows an additive effect with a further 50% reduction in fusion frequency. This indicates that the altered sterol composition affects membrane fusion through mechanisms that operate in parallel to known fusion proteins. The specificity of this defect is notable since it occurs only in certain sterol biosynthesis mutants, highlighting how subtle differences in sterol structure can have significant impacts on biological processes .

How do erg-1 mutations compare with other ergosterol biosynthesis mutants?

Comparative analysis of different ergosterol biosynthesis mutants reveals distinctive patterns that provide insights into the role of specific sterol structures:

MutantAccumulated Sterol(s)Membrane Fusion PhenotypeOther Phenotypic Characteristics
Δerg-1Ergosta-8,22-dienol, Fecosterol, third intermediate (all with C-8/C-9 double bond)~50% reduction in fusion; membrane invaginationsDelayed growth; developmental defects; characteristic pigmentation
Δerg-10a/Δerg-10bErgosta-7,22-dienol (missing double bond in ring system)~50% reduction in fusion; membrane invaginationsSimilar to Δerg-1 in appearance and pigmentation
Other erg mutantsVarious sterol intermediatesGenerally normal membrane fusionVarious developmental defects

These comparisons highlight how specific structural features of sterols differentially impact membrane properties and protein functions, with certain sterol modifications causing highly specific cellular defects.

What experimental approaches can determine the biochemical activity of recombinant erg-1?

Determining the biochemical activity of recombinant erg-1 requires specialized approaches that address the challenges of working with membrane-associated enzymes involved in lipid modification. Several experimental strategies can be employed:

Experimental ApproachMethodologyKey Considerations
In vitro isomerase assayIncubate purified recombinant erg-1 with sterol substrates (e.g., ergosta-8,9-enol); analyze products by GC/MS or HPLCRequires pure, active enzyme; may need detergent or lipid reconstitution systems to maintain activity
Complementation studiesExpress recombinant erg-1 in Δerg-1 N. crassa or S. cerevisiae erg2 mutants; analyze restoration of ergosterol synthesisAssesses functional activity in a cellular context; confirms substrate specificity
Chimeric protein analysisCreate chimeras between erg-1 and homologs (e.g., S. cerevisiae Erg2); test functionality in appropriate mutant backgroundsIdentifies functional domains and structure-function relationships
Spectroscopic analysisMonitor spectral changes during sterol isomerization (e.g., UV absorption shifts from ~250 nm to ergosterol-specific peaks)Can provide real-time kinetic data on isomerase activity

A particularly informative approach involves the construction of chimeric proteins, similar to studies conducted with erg-3, where chimeras between Neurospora erg-3 and human proteins were created to test functional conservation and identify critical domains . Such chimeras between erg-1 and homologous proteins could reveal which structural elements are essential for the specific isomerase activity and substrate recognition.

How can researchers quantitatively assess erg-1's impact on membrane biophysical properties?

The impact of erg-1 on membrane biophysical properties represents a crucial aspect of understanding how sterol structure influences membrane function. Several advanced biophysical techniques can provide quantitative insights:

TechniqueMeasurementRelevance to erg-1 Research
Fluorescence anisotropyMembrane fluidity and microviscosityDetermines how altered sterol structure affects membrane rigidity
Differential scanning calorimetryPhase transition temperaturesReveals how altered sterols impact membrane phase behavior
Atomic force microscopyNanomechanical properties and domain organizationVisualizes membrane topography and mechanical properties at nanoscale
Laurdan generalized polarizationLipid packing and hydrationMeasures changes in membrane order due to altered sterol composition
Giant unilamellar vesicle (GUV) assaysMembrane fusion efficiency with defined lipid compositionsDirectly tests how specific sterols influence membrane fusion kinetics
Small-angle X-ray scatteringMembrane thickness and structural organizationProvides detailed structural information about membrane organization

These approaches can be applied to both artificial membrane systems reconstituted with purified lipids and sterols, and to native membranes isolated from wild-type and Δerg-1 strains. Comparing the biophysical properties of membranes containing normal ergosterol versus the sterol intermediates that accumulate in Δerg-1 mutants can provide mechanistic insights into how specific structural features of sterols influence membrane properties and functions, particularly those relevant to membrane fusion .

What techniques can be used to express and purify recombinant erg-1 protein?

Expression and purification of recombinant erg-1 protein requires careful consideration of its membrane-associated nature and potential requirements for proper folding and activity. Based on available information, recombinant Neurospora crassa C-8 sterol isomerase (erg-1) has been successfully expressed with a His-tag in E. coli systems . The following protocol outlines a comprehensive approach:

StageMethodologyTechnical Considerations
Vector constructionClone full-length erg-1 coding sequence (1-256 amino acids) into expression vector with His-tagCodon optimization may improve expression in E. coli; consider N- or C-terminal tag placement
Expression systemE. coli BL21(DE3) or similar strainAlternative systems (yeast, insect cells) may be considered if bacterial expression yields inactive protein
Culture conditionsLB media with appropriate antibiotic; induce at OD600 ~0.6-0.8 with IPTG (0.1-1.0 mM)Lower induction temperature (16-25°C) may improve folding of membrane-associated proteins
Cell lysisSonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, protease inhibitorsAddition of mild detergents (0.5-1% Triton X-100 or 0.5% CHAPS) may improve solubilization
PurificationNi-NTA affinity chromatography; elute with imidazole gradient (50-300 mM)Consider on-column refolding if protein forms inclusion bodies
Secondary purificationSize exclusion chromatography to remove aggregates and improve purityBuffer should contain stabilizing agents (glycerol, reducing agents)
Quality controlSDS-PAGE, Western blot, and activity assay to confirm identity and functionalityActivity assay could involve measuring conversion of sterol substrates by GC/MS

When working with membrane-associated enzymes like erg-1, maintaining protein stability and activity throughout the purification process is particularly challenging. Incorporation of appropriate detergents or lipids in purification buffers may be essential for preserving the native conformation and enzymatic activity .

What strategies can be employed for creating and validating erg-1 knockout strains?

Creating and validating erg-1 knockout strains requires careful genetic manipulation followed by comprehensive phenotypic and molecular characterization. Based on successful generation of Δerg-1 strains reported in the literature, the following strategy can be employed:

StageMethodologyTechnical Considerations
Knockout construct designDesign construct with selectable marker (e.g., hygromycin resistance) flanked by ~1kb homologous sequences upstream and downstream of erg-1PCR-stitching approach can be effective as demonstrated for other genes in N. crassa
TransformationPEG-mediated transformation of N. crassa conidia or protoplastsOptimized protocols for N. crassa transformation are well-established in the literature
Primary transformant selectionCulture on media containing appropriate selective agent (e.g., hygromycin)Multiple transformants should be isolated and screened
Molecular verificationPCR verification of correct integration; Southern blot analysis for copy numberUse primers that span the integration junctions to confirm proper insertion
BackcrossingCross primary transformants with wild-type strain to obtain knockout progenyImportant for eliminating off-target mutations; backcrossing revealed significant growth delays in Δerg-1 progeny
Sterol composition analysisGC/MS analysis to confirm altered sterol profileShould show accumulation of specific intermediates with C-8/C-9 double bonds
Phenotypic characterizationAssess growth, development, pigmentation, and germling fusionExpect characteristics similar to those reported: pigmentation changes, developmental delays, and membrane fusion defects

It's important to note that erg-1 knockout strains exhibit significant growth and developmental delays, which should be considered when designing experiments and interpreting results. The characteristic phenotypes of Δerg-1, including altered pigmentation and impaired membrane fusion, provide useful markers for validating successful gene deletion .

What analytical methods best characterize sterol composition in erg-1 mutant strains?

Comprehensive characterization of sterol composition in erg-1 mutant strains requires sophisticated analytical techniques that can identify and quantify specific sterol intermediates:

Analytical MethodApplicationSpecific Parameters for erg-1 Research
Gas Chromatography/Mass Spectrometry (GC/MS)Separation and identification of sterols based on retention times and mass spectraSuccessfully used to identify ergosta-8,22-dienol, fecosterol, and other intermediates in Δerg-1 strains
High-Performance Liquid Chromatography (HPLC)Alternative separation technique; particularly useful for thermally labile sterolsCan be coupled with different detectors (UV, mass spectrometry) for sterol identification
UV SpectroscopyCharacteristic absorption spectra of different sterolsErgosterol has specific absorption maxima at 272, 282, and 293 nm; mutant sterols show different profiles
Sterol extraction protocolEssential preliminary stepExtract non-saponifiable lipids using hexane after saponification; dissolve in ethanol for spectroscopic analysis
Thin-Layer Chromatography (TLC)Rapid screening of sterol profilesCan provide preliminary data before more detailed GC/MS analysis
Nuclear Magnetic Resonance (NMR)Detailed structural characterization of purified sterolsProvides precise information about double bond positions and configurations

For erg-1 research, GC/MS has proven most effective in characterizing the specific sterol intermediates that accumulate when the isomerization step is blocked. The distinctive double bond arrangement in these intermediates (C-8/C-9 instead of C-7/C-8) can be conclusively identified using this technique . Combined with UV spectroscopy for initial screening and potentially NMR for detailed structural confirmation, these methods provide a comprehensive toolset for sterol analysis in erg-1 mutants.

How can researchers quantitatively assess membrane fusion defects in erg-1 mutants?

Quantitative assessment of membrane fusion defects in erg-1 mutants requires a combination of microscopic and molecular approaches that can precisely measure fusion efficiency and characterize fusion intermediates:

ApproachMethodologyQuantitative Parameters
Germling interaction assayCount percentage of germlings that establish physical contactΔerg-1 germlings show normal interaction frequency (81.7 ± 0.9%, comparable to wild-type)
Fusion frequency measurementCount percentage of interacting germling pairs that complete cytoplasmic continuityApproximately 50% reduction in Δerg-1 compared to wild-type
Membrane invagination analysisConfocal or electron microscopy to visualize membrane structures at contact sitesQuantify percentage of contacts showing invaginations vs. successful fusion
Fluorescent cytoplasmic mixing assayExpress different fluorescent proteins in paired strains; measure transfer after contactProvides temporal data on fusion dynamics and efficiency
Genetic interaction analysisCreate double mutants with known fusion genes (e.g., Prm1, lfd-1); measure fusion frequenciesΔerg-1/ΔPrm1 shows additive defect (further 50% reduction); Δerg-1/Δlfd-1 shows intermediate phenotype (62% fusion frequency)
Lipid mixing assaysLabel membranes with lipophilic dyes; measure mixing during fusion attemptsDistinguishes between hemifusion (outer leaflet mixing only) and complete fusion

The combination of these approaches provides multi-dimensional data on how altered sterol composition impacts specific stages of the membrane fusion process. The observation that Δerg-1 germlings establish normal contacts but exhibit reduced fusion frequency and characteristic membrane invaginations suggests that the fusion defect occurs specifically at the membrane merger stage rather than during initial recognition or contact .

What experimental designs can elucidate the relationship between sterol structure and membrane fusion?

Understanding the precise relationship between sterol structure and membrane fusion requires sophisticated experimental designs that can isolate the effects of specific structural features:

Experimental ApproachDesignExpected Outcomes
Comparative mutant analysisCompare fusion phenotypes across mutants accumulating sterols with specific structural variationsRevealed that both Δerg-1 and Δerg-10a/Δerg-10b show similar fusion defects despite different sterol structures
Sterol supplementation experimentsCulture Δerg-1 with external ergosterol or specific intermediates; assess rescue of fusion defectsCan determine which structural features are essential for normal fusion
Synthetic membrane fusion assaysCreate liposomes with defined lipid compositions including different sterols; measure fusion ratesDirectly tests how specific sterol structures influence membrane biophysical properties
Domain-swapping experimentsCreate chimeric proteins between erg-1 and related enzymes; test effects on sterol structure and fusionIdentifies specific enzyme domains responsible for critical structural modifications
Structure-function correlationSystematically correlate specific sterol structural features with quantitative fusion parameters across multiple mutantsCan reveal which aspects of sterol structure (ring system, side chain) are most critical
Molecular dynamics simulationsComputational modeling of membranes containing different sterols during fusion eventsProvides mechanistic insights into how sterol structure influences membrane behavior during fusion

Research has already established that the structure of the sterol ring system specifically affects plasma membrane merger during the fusion of vegetative spore germlings. The double bond arrangement in the B ring appears particularly important, as both Δerg-1 and Δerg-10a/Δerg-10b mutants show similar fusion defects despite accumulating different sterol intermediates with alterations in this region .

Further experiments using the approaches outlined above could precisely define which structural features of sterols are most critical for membrane fusion and how they influence the physical properties of membranes and the function of fusion proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.