Recombinant Neurospora crassa Chitin synthase export chaperone (chs-7)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Neurospora crassa Chitin Synthase Export Chaperone (chs-7)

Recombinant Neurospora crassa Chitin Synthase Export Chaperone (chs-7) is a transmembrane protein critical for the trafficking of chitin synthases (CHS) in filamentous fungi. It belongs to the Shr3-like chaperone family and plays a pivotal role in the biogenesis of chitin, a structural polysaccharide essential for fungal cell wall integrity and morphogenesis. The recombinant form of chs-7 is produced in heterologous systems (e.g., E. coli, yeast) and is used to study its biochemical and functional properties.

Biological Role in Chitin Synthesis

chs-7 is indispensable for the proper localization and activity of CHS-4 (Class IV chitin synthase) in Neurospora crassa. Key findings include:

  • ER Export: chs-7 ensures CHS-4 exits the ER and reaches the SPK and septa, where chitin synthesis occurs. In Δcse-7 mutants, CHS-4-GFP fluorescence is absent from these sites, leading to defective cell wall formation .

  • Chitin Content: Double mutants (Δcse-7;Δcse-8) exhibit reduced N-acetylglucosamine (GlcNAc) content and impaired radial growth, highlighting chs-7’s role in maintaining chitin synthesis .

  • Sexual Development: Δcse-7 strains show disrupted perithecia formation, with 20% of fruiting bodies having abnormal ostioles .

Mechanism of Action

chs-7 interacts with CHS-4 to:

  1. Prevent Aggregation: Ensure proper folding in the ER.

  2. Facilitate Vesicular Transport: Guide CHS-4-containing chitosomes to the SPK via COPII vesicles .

  3. Regulate Activity: Modulate CHS-4’s enzymatic function at the plasma membrane .

Recombinant Production and Applications

Recombinant chs-7 is widely used in research to study fungal cell wall biogenesis. Below is a comparative analysis of its production systems:

Host SystemTagPurityApplicationsSource
E. coliHis-tag>90% (SDS-PAGE)Structural studies, enzymatic assays
YeastNone≥85%Functional complementation experiments
Cell-FreeN/A≥85%Biochemical assays, interaction studies

Key Applications

  • Biochemical Studies: Used to characterize chs-7’s interaction with CHS-4 and other ER proteins .

  • Structural Analysis: His-tagged recombinant chs-7 enables crystallization and cryo-EM studies .

  • Therapeutic Research: Serves as a target for antifungal agents disrupting CHS trafficking .

Localization and Dynamics

chs-7-GFP colocalizes with CHS-4 at the SPK and septa. ER stressors (e.g., tunicamycin) disrupt this localization, causing CHS-4 accumulation in the ER .

Conservation Across Fungi

chs-7 orthologs exist in Trichoderma, Aspergillus, and Candida, but filamentous fungi uniquely possess two CSE proteins (CSE-7/CSE-8) compared to yeast’s single CHS7 .

Functional Redundancy and Synergy

  • CSE-7 vs. CSE-8: CSE-7 regulates CHS-4 (Class IV), while CSE-8 governs CHS-3 (Class I). Their combined loss causes severe chitin defects .

  • SPK-Dependent Traffic: Both CSE-7 and CSE-8 localize to vesicles near the SPK, suggesting distinct trafficking pathways for different CHS classes .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference in the order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
csc-1; chs7; NCU05720; Chitin synthase export chaperone; Chitin synthase chaperone 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
csc-1
Target Protein Sequence
MGKFGDFSSICRMAPIPLCASVGPITSIATGVGIEPDCYARNIEVANTIIFQGAASVMHI VALVMTVVMLLHVRGKFTAVGRKEITTFFYLYMILTFLSLCIDAGVIPPHSGSYPYFVAV QAGLASALVTCLVINGFVGFQLYEDGTPLSLWMLRLCSFVAFVISFLVGLATFKSWAGLG PTNTVGIFVVLYFLNALQLLLYVVMQIILVTRTLQDRWPLGDIAFGLFFFIAGQVILYAF SSPICEGISHYLDGLFFATTCNLLAVMMVYKYWDSITKEDLEFSVGTRMNNWEVKELLPQ GPEEDRRATVYADPIYEGHYASGPGTGSGASASGYEGGHHRRESHGYTPSPNRQSLRY
Uniprot No.

Target Background

Function
This chaperone protein is essential for the export of the chitin synthase chs-3 from the endoplasmic reticulum.
Database Links

KEGG: ncr:NCU05720

Protein Families
CHS7 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Neurospora crassa Chitin Synthase Export chaperone (CSE-7) and what is its role in fungal biology?

Neurospora crassa Chitin Synthase Export chaperone 7 (CSE-7, encoded by NCU05720) is one of two orthologues of the yeast Chs7 protein found in N. crassa . It functions as a specialized chaperone that facilitates the transport of chitin synthase 4 (CHS-4, a class IV chitin synthase) from the endoplasmic reticulum (ER) to sites of active cell wall synthesis, particularly the Spitzenkörper (SPK) and septa . CSE-7 is structurally characterized as a 358 amino acid protein (39.3 kDa) that contains seven transmembrane alpha-helix regions and four cytoplasmic domains with conserved amino acid residues . Unlike its paralog CSE-8, CSE-7 possesses a distinctive long-disordered domain at its C-terminal region, which may contribute to its specialized function .

How does CSE-7 compare structurally to other chitin synthase export chaperones?

CSE-7 belongs to a small group of ER chaperone-like transmembrane proteins known as the "Shr3-like" protein family, which includes Shr3, Pho86, Gsf2, and Chs7 in Saccharomyces cerevisiae . These chaperones are specialized in preventing aggregation of plasma membrane proteins at the ER by ensuring proper folding. When comparing N. crassa's two chitin synthase export chaperones:

FeatureCSE-7 (NCU05720)CSE-8 (NCU01814)S. cerevisiae Chs7
Size (amino acids)358299316
Molecular weight39.3 kDa33.1 kDa34.9 kDa
Transmembrane regions777
Cytoplasmic domains444
C-terminal regionLong-disordered domainAbsentAbsent
Sequence identity to CSE-7100%31.12%25.42%
Target chitin synthaseCHS-4 (Class IV)CHS-3 (Class I)Chs3

The presence of a unique C-terminal disordered domain in CSE-7 likely contributes to its specific functionality in facilitating CHS-4 transport .

What is the evolutionary significance of having two Chs7 orthologues in filamentous fungi?

Unlike yeasts, which possess only a single chitin synthase export chaperone (Chs7), filamentous fungi like N. crassa have evolved two separate orthologues (CSE-7 and CSE-8) that perform specialized functions . This duplication and subsequent specialization likely reflect the more complex cell wall architecture and developmental processes in filamentous fungi.

In N. crassa, the genome encodes seven different classes of chitin synthases, compared to only three in S. cerevisiae . This expansion of the chitin synthase family in filamentous fungi has likely driven the parallel evolution of specialized export chaperones to ensure proper trafficking of specific chitin synthases. The specialized nature of CSE-7 for CHS-4 transport and CSE-8 for CHS-3 transport demonstrates functional divergence after gene duplication, allowing for more refined regulation of cell wall biogenesis during various developmental stages and environmental conditions in filamentous fungi .

What are the phenotypic consequences of CSE-7 deletion in N. crassa?

The deletion of the cse-7 gene in N. crassa (Δcse-7) does not result in significant phenotypic alterations, which is consistent with the phenotype observed in the Δchs-4 strain . This suggests that the CSE-7-mediated transport of CHS-4 may be functionally redundant with other chitin synthesis pathways in N. crassa.

Interestingly, this phenotypic outcome differs from observations in other filamentous fungi. For instance, in Trichoderma atroviridae, the Δcse-7 strain exhibits noticeable changes in colony morphology, characterized by stratified mycelium with abundant branching . This interspecies difference highlights the evolutionary divergence in the roles of chitin synthase export chaperones across filamentous fungi.

In contrast, the double deletion mutant Δcse-7;Δcse-8 in N. crassa shows more pronounced phenotypic effects, including reduced N-acetylglucosamine (GlcNAc) content and decreased radial growth . This suggests that while individual deletions may be compensated for by redundant mechanisms, the simultaneous loss of both chitin synthase export chaperones significantly compromises chitin synthesis and hyphal growth.

How does the CSE-7 chaperone mechanism differ from conventional molecular chaperones?

Unlike conventional molecular chaperones that interact with a broad range of proteins, CSE-7 belongs to the "Shr3-like" family of specialized chaperones that demonstrate cargo selectivity . These proteins lack conserved domains common to other chaperone families and function primarily to prevent the aggregation of specific plasma membrane proteins at the ER by ensuring proper folding .

The mechanism of CSE-7 appears to include:

  • Selective recognition of CHS-4 in the endoplasmic reticulum

  • Prevention of CHS-4 aggregation during folding

  • Facilitation of CHS-4 incorporation into COPII vesicles

  • Transport from the ER to the Spitzenkörper and septa

By analogy with the yeast Shr3 protein, CSE-7 likely utilizes its hydrophilic C-terminal domain to associate with COPII coatomer subunits, facilitating CHS-4 transport through the secretory pathway . This specialized interaction differs fundamentally from the ATP-dependent, broad-specificity folding mechanisms characteristic of Hsp70 or Hsp90 family chaperones.

What methodologies are most effective for studying CSE-7 localization and trafficking in vivo?

Based on research approaches documented for similar proteins, the following methodologies are recommended for investigating CSE-7 localization and trafficking:

  • Fluorescent protein tagging: Generation of CSE-7-GFP fusion constructs allows for live-cell imaging of CSE-7 localization and dynamics . This approach has been successfully implemented for CSE-8-GFP, revealing its subcellular distribution and response to ER stress .

  • Co-localization studies: Dual-labeling of CSE-7 and its cargo CHS-4 with different fluorescent tags (e.g., GFP and RFP) enables visualization of their interaction and co-trafficking through the secretory pathway.

  • FRAP (Fluorescence Recovery After Photobleaching): This technique can be used to assess the mobility and turnover rate of CSE-7 in different cellular compartments.

  • ER stress induction: Treatment with tunicamycin and dithiothreitol, as demonstrated for CSE-8 , can provide insights into how ER stress affects CSE-7 localization and function.

  • Organelle markers: Co-expression of CSE-7-GFP with markers for different organelles (ER, Golgi, endosomes) helps to precisely track its intracellular movement.

  • Time-lapse microscopy: This approach is particularly valuable for observing the dynamic localization of CSE-7 during hyphal growth and septum formation.

How do experimental procedures for recombinant expression and purification of CSE-7 differ from those for soluble proteins?

The recombinant expression and purification of CSE-7 presents unique challenges due to its seven transmembrane domains . Standard approaches for membrane protein purification must be modified:

Experimental StageStandard Soluble ProteinCSE-7 (Membrane Protein) Modifications
Expression systemE. coli BL21(DE3)Specialized membrane protein expression strains (e.g., C41/C43) or eukaryotic systems
Growth conditionsStandard LB mediaSupplemented media with glycerol; lower induction temperatures (16-20°C)
Cell lysisStandard mechanical disruptionGentle disruption to preserve membrane integrity
SolubilizationDirect buffer extractionRequires detergent screening (e.g., DDM, LMNG, SDS) for optimal solubilization
Purification strategyStandard affinity chromatographyDetergent must be maintained throughout purification; consider lipid addition
Buffer compositionStandard aqueous buffersDetergent-containing buffers; potential lipid supplementation
Storage conditionsGlycerol, -80°CDetergent critical micelle concentration must be maintained; potential reconstitution into liposomes

Successful purification requires screening multiple detergents for optimal solubilization while maintaining protein stability and function. For functional studies, reconstitution into liposomes or nanodiscs may be necessary to provide a native-like membrane environment.

What is the molecular relationship between Neurospora crassa CSE-7 and chitin synthase trafficking in comparison with other filamentous fungi?

In N. crassa, CSE-7 specifically facilitates the transport of CHS-4 (class IV CHS), while CSE-8 is involved in trafficking CHS-3 (class I) . This specialized cargo selection suggests evolution of distinct trafficking pathways for different chitin synthase classes.

Interestingly, different orthologues can have divergent functions even in closely related species. For example, the phenotype of Δchs-6 in N. crassa (strongly reduced vegetative growth and delayed sexual development) differs significantly from that of the orthologous Δchs7 in Sordaria macrospora, which grows normally and exhibits wild type-like sexual development . This functional divergence between orthologues demonstrates that gene function can evolve differently even in closely related species.

In Trichoderma atroviridae, the Δcse-7 strain shows noticeable morphological changes not observed in N. crassa, indicating species-specific roles for these chaperones . This suggests that while the basic mechanism of chitin synthase export is conserved, its functional significance has diverged during the evolution of different filamentous fungi.

What experimental controls are essential when investigating CSE-7 function in chitin synthase transport?

When designing experiments to investigate CSE-7 function, several key controls should be incorporated:

  • Genetic complementation: Reintroduction of the wild-type cse-7 gene into the Δcse-7 strain to verify restoration of phenotype.

  • Negative chaperone control: Parallel experiments with deletion of a non-related chaperone to demonstrate specificity of CSE-7 effects.

  • Cargo specificity controls: Tracking the localization of multiple chitin synthases (not just CHS-4) in Δcse-7 strains to confirm cargo specificity.

  • Membrane protein controls: Examining the transport of non-chitin synthase membrane proteins to verify that general membrane protein trafficking is unaffected.

  • ER stress markers: Monitoring markers of ER stress to ensure that observed phenotypes are not due to general ER dysfunction.

  • Double mutant analysis: Creation of Δcse-7;Δcse-8 double mutants to assess potential functional redundancy or synthetic phenotypes .

  • Cell wall integrity controls: Inclusion of assays for cell wall composition and integrity to correlate trafficking defects with functional outcomes.

  • Developmental stage controls: Examination of CSE-7 function across different developmental stages to account for potential temporal regulation.

How can researchers distinguish between direct and indirect effects of CSE-7 on chitin synthase activity?

Distinguishing direct from indirect effects requires a multi-faceted experimental approach:

  • Enzyme activity assays: Measure chitin synthase activity in membrane fractions from wild-type and Δcse-7 strains. Direct effects on enzyme activity would be evident even in isolated membrane preparations.

  • In vitro reconstitution: Purify CHS-4 and CSE-7 and reconstitute them in liposomes to test whether CSE-7 directly affects CHS-4 catalytic activity.

  • Site-directed mutagenesis: Create point mutations in CSE-7 that disrupt interaction with CHS-4 but maintain protein stability to separate transport from potential regulatory functions.

  • Protein-protein interaction studies: Use techniques like co-immunoprecipitation, proximity labeling, or FRET to confirm direct physical interaction between CSE-7 and CHS-4.

  • Subcellular fractionation: Isolate different membrane compartments to determine where CHS-4 accumulates in Δcse-7 mutants, confirming a transport rather than activity defect.

  • Temporal analysis: Use inducible promoters to control CSE-7 expression and monitor immediate versus delayed effects on chitin synthesis.

  • Cell wall composition analysis: Quantify N-acetylglucosamine content to determine if there are changes in chitin deposition in the Δcse-7 strain compared to wild-type .

What bioinformatic approaches can be used to identify potential regulatory sequences in the CSE-7 gene and its orthologues?

Several computational approaches can help identify regulatory elements in CSE-7:

  • Promoter analysis: Use tools like MEME, JASPAR, or TRANSFAC to identify transcription factor binding sites in the promoter region of cse-7.

  • Comparative genomics: Analyze syntenic regions across related filamentous fungi to identify conserved non-coding sequences that may represent regulatory elements.

  • RNA-seq analysis: Examine expression correlation networks to identify genes co-regulated with cse-7, suggesting shared regulatory mechanisms.

  • ChIP-seq data mining: Analyze available chromatin immunoprecipitation data to identify transcription factors that bind to the cse-7 promoter.

  • Epigenetic analysis: Investigate DNA methylation patterns and histone modifications in the cse-7 locus under different growth conditions.

  • UTR analysis: Examine 5' and 3' untranslated regions for regulatory elements affecting mRNA stability or translation efficiency.

  • Developmental expression profiling: Compare expression levels of cse-7 across different developmental stages to identify potential stage-specific regulation.

  • Stress response elements: Screen for known stress response elements given that ER stress affects the function of related proteins like CSE-8 .

How can CRISPR-Cas9 technology be optimized for studying CSE-7 function in Neurospora crassa?

CRISPR-Cas9 offers powerful approaches for functional analysis of CSE-7:

  • Guide RNA design optimization:

    • Select target sites with minimal off-target effects using N. crassa-specific prediction algorithms

    • Target conserved domains within the cse-7 gene for maximum disruption

    • Design multiple gRNAs targeting different regions to increase editing efficiency

  • Delivery methods:

    • Optimize protoplast transformation protocols specific for N. crassa

    • Consider using ribonucleoprotein (RNP) complexes rather than plasmid-based expression

    • Adjust regeneration conditions to maximize transformation efficiency

  • Advanced editing strategies:

    • Generate domain-specific mutations rather than complete gene deletion

    • Create conditional alleles using inducible promoters

    • Implement base editing to introduce specific amino acid changes

    • Use homology-directed repair to introduce tagged versions of CSE-7

  • Experimental validation:

    • Implement droplet digital PCR to accurately quantify editing efficiency

    • Use deep sequencing to verify the absence of off-target effects

    • Confirm knockout at both DNA and protein levels

  • Multiplexed editing:

    • Simultaneously target cse-7 and cse-8 to generate double mutants

    • Target multiple domains within CSE-7 to determine domain-specific functions

    • Edit CSE-7 alongside its cargo CHS-4 to study their functional relationship

What approaches can resolve contradictory findings between CSE-7 function in different fungal species?

The observed differences in phenotypes between CSE-7 orthologues in different fungi can be addressed through:

  • Heterologous expression: Express CSE-7 orthologues from different species in N. crassa Δcse-7 and assess functional complementation.

  • Domain swapping: Create chimeric proteins by swapping domains between CSE-7 orthologues to identify regions responsible for species-specific functions.

  • Evolutionary analysis: Conduct detailed phylogenetic analysis coupled with tests for positive selection to identify rapidly evolving regions.

  • Subcellular localization comparison: Compare the localization patterns of CSE-7 orthologues when expressed in the same fungal species.

  • Interactome analysis: Identify and compare protein-protein interaction networks for CSE-7 orthologues across species.

  • Developmental context assessment: Examine CSE-7 function across different developmental stages in multiple species to identify context-dependent functions.

  • Environmental responses: Test phenotypes under various stress conditions to determine if functional differences emerge under specific environmental challenges.

  • Standardized methodologies: Develop standardized experimental protocols to be applied consistently across fungal species, eliminating methodological differences as a source of contradictory results.

How might CSE-7 function be leveraged for applications in fungal biotechnology?

Understanding CSE-7 function opens several potential biotechnological applications:

  • Engineered cell wall properties: Manipulation of CSE-7 and its cargo could allow tailoring of fungal cell wall properties for industrial applications.

  • Improved heterologous protein secretion: Insights from CSE-7-mediated trafficking could inform strategies to enhance secretion of recombinant proteins in filamentous fungi.

  • Antifungal drug development: CSE-7's essential role in chitin synthase trafficking makes it a potential target for novel antifungal therapeutics.

  • Fungal strain improvement: Engineering CSE-7 expression or activity could potentially enhance growth rates or stress tolerance in industrial fungal strains.

  • Biosensors: CSE-7-based trafficking reporters could serve as biosensors for ER stress or cell wall integrity.

  • Synthetic biology platforms: The cargo specificity of CSE-7 could be exploited for directed trafficking of engineered membrane proteins.

  • Bioremediation applications: Enhanced understanding of cell wall biogenesis through CSE-7 studies could lead to fungal strains with improved capabilities for bioremediation of environmental contaminants.

What implications does CSE-7 research have for understanding broader aspects of protein trafficking in filamentous fungi?

Research on CSE-7 provides valuable insights into several broader aspects of protein trafficking:

  • Evolutionary specialization: The presence of two Chs7 orthologues (CSE-7 and CSE-8) in filamentous fungi compared to a single orthologue in yeasts highlights how increased morphological complexity drives specialization in trafficking machinery .

  • Organelle-to-plasma membrane trafficking: The transport of chitin synthases from the ER to the Spitzenkörper and ultimately to the plasma membrane serves as a model for understanding polarized secretion in filamentous fungi .

  • Developmental regulation: Studying how CSE-7-mediated trafficking changes during different developmental stages can illuminate mechanisms of developmental transitions in fungi.

  • Stress response adaptation: The relationship between ER stress and CSE-7 function may reveal broader principles about how protein trafficking adapts to cellular stress .

  • Cargo specificity mechanisms: Understanding how CSE-7 specifically recognizes CHS-4 while CSE-8 recognizes CHS-3 provides insights into cargo selection in the early secretory pathway .

  • Vesicle transport systems: The incorporation of CSE-7 and its cargo into transport vesicles offers a model for studying vesicle biogenesis and transport in polarized fungal cells.

  • Cell wall biogenesis coordination: CSE-7 research illuminates how multiple trafficking pathways for different cell wall biosynthetic enzymes are coordinated during hyphal growth and development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.