Recombinant Neurospora crassa Cytochrome b-c1 complex subunit Rieske, mitochondrial (NCU06606)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Neurospora crassa Cytochrome b-c1 Complex Subunit Rieske, Mitochondrial (NCU06606)

Recombinant Neurospora crassa Cytochrome b-c1 complex subunit Rieske, mitochondrial (NCU06606), also known as Rieske iron-sulfur protein (RISP), is a component of the cytochrome $$bc_1$$ complex, or complex III, in the mitochondrial respiratory chain . This protein participates in electron transfer from ubiquinol to cytochrome c, a process coupled with proton translocation across the inner mitochondrial membrane .

Basic Information

FeatureDescription
Gene NameNCU06606
Synonymsfes-1, Complex III subunit 5, Rieske iron-sulfur protein, RISP, Ubiquinol-cytochrome c oxidoreductase iron-sulfur subunit, Ubiquinol-cytochrome c reductase complex 25
UniProt IDP07056
SpeciesNeurospora crassa
Protein LengthFull Length of Mature Protein (33-231aa)
TagHis
SourceE. coli
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE

Gene and Protein Structure

The gene encoding the Rieske iron-sulfur polypeptide (RIS) is a single copy gene (NCU06606.3) of 1264 bp and contains three introns of 325 bp, 122 bp and 121 bp respectively . It codes for a protein of 231 amino acid residues with a predicted molecular mass of 24 770.66 Da, carrying a putative mitochondrial presequence of 32 amino acids and a putative transmembrane domain at the N-terminus (residues 69–86), conserved in its homologues . RIS contains the characteristic Rieske [2Fe-2S] domain responsible for the co-ordination of a binuclear iron-sulphur cluster that also exists in three other N. crassa proteins, the apoptosis inducing factor (NCU05850.3), the nitrite reductase (NCU04720.3) and in a FAD-dependent .

Experimental Uses

Recombinant NCU06606 is utilized in various experimental settings, including:

  • In vitro assays: Studying protein-protein interactions and electron transfer mechanisms .

  • Structural studies: Determining the protein's three-dimensional structure and its interaction with other components of the cytochrome $$bc_1$$ complex .

  • Antibody Production: Generating antibodies for research applications .

Related proteins

  • Oxa2 protein: The Oxa2 protein of N. crassa complements Cox18-deficient yeast mutants suggesting a common function for both proteins .

  • Mitochondrial ribosomal proteins: Neurospora crassa contains at least three nuclear genes for mitochondrial ribosomal proteins .

  • Cytochrome c1: Recombinant Schizosaccharomyces pombe Cytochrome c1, heme protein, mitochondrial (cyt1) .

  • qcr9: Cytochrome $$b-c_1$$ complex subunit 9, mitochondrial .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
fes-1; NCU06606; Cytochrome b-c1 complex subunit Rieske, mitochondrial; Complex III subunit 5; Complex III subunit V; Rieske iron-sulfur protein; RISP; Ubiquinol-cytochrome c oxidoreductase iron-sulfur subunit; Ubiquinol-cytochrome c reductase complex 25 kDa protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-231
Protein Length
Full Length of Mature Protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
NCU06606
Target Protein Sequence
GSSSSTFESPFKGESKAAKVPDFGKYMSKAPPSTNMLFSYFMVGTMGAITAAGAKSTIQE FLKNMSASADVLAMAKVEVDLNAIPEGKNVIIKWRGKPVFIRHRTPAEIEEANKVNVATL RDPETDADRVKKPEWLVMLGVCTHLGCVPIGEAGDYGGWFCPCHGSHYDISGRIRKGPAP LNLEIPLYEFPEEGKLVIG
Uniprot No.

Target Background

Function
Recombinant *Neurospora crassa* Cytochrome b-c1 complex subunit Rieske, mitochondrial (NCU06606) is a component of the ubiquinol-cytochrome c oxidoreductase. This multisubunit transmembrane complex is part of the mitochondrial electron transport chain, driving oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes cooperate to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, coupling this redox reaction to proton translocation across the inner mitochondrial membrane via the Q cycle. In this process, two protons are consumed from the matrix, four protons are released into the intermembrane space, and two electrons are transferred to cytochrome c. The Rieske protein, a catalytic core subunit, contains a [2Fe-2S] iron-sulfur cluster and cycles between two conformational states during catalysis to transfer electrons from the quinol bound in the Q(0) site in cytochrome b to cytochrome c1.
Database Links

KEGG: ncr:NCU06606

Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the Rieske iron-sulfur protein in N. crassa and what role does it play in mitochondrial function?

The Rieske iron-sulfur protein (ISP) is one of the catalytic subunits of the cytochrome bc1 complex (Complex III) in the mitochondrial respiratory chain. This protein contains an iron-sulfur cluster that facilitates electron transfer from ubiquinol to cytochrome c during oxidative phosphorylation. In Neurospora crassa, as in other organisms, the absence of this protein prevents the formation of functional respiratory supercomplexes and disrupts normal electron transport chain activity. The Rieske protein is specifically required for the final assembly stages of the bc1 complex and subsequent interactions with other respiratory complexes .

The protein's importance extends beyond its catalytic function, as it also plays a structural role in the complete assembly of the bc1 complex. Studies in yeast have shown that without the Rieske protein, a stable but incomplete bc1 sub-complex of approximately 500 kDa can still form, but this sub-complex lacks the ability to interact with cytochrome c oxidase to form respiratory supercomplexes .

How is the Rieske protein integrated into the cytochrome bc1 complex assembly pathway?

The assembly of the cytochrome bc1 complex follows a sequential pathway in which the Rieske protein is not incorporated until relatively late in the process. Based on studies in yeast, which have a similar bc1 complex structure, a core assembly intermediate of approximately 500 kDa forms first, containing cytochrome b, cytochrome c1, core protein 1, core protein 2, and the small subunits Qcr7p and Qcr8p. This core structure is stable and represents a true assembly intermediate .

The Rieske protein incorporation requires the presence of specific chaperone proteins, particularly Bcs1p, which facilitates its insertion into the developing complex. Before the Rieske protein can be incorporated, subunit Qcr9p must be integrated into the complex. Once the Rieske protein is successfully incorporated, the final subunit Qcr10p can join the complex, completing its assembly. Only the fully assembled complex can then participate in forming respiratory supercomplexes with cytochrome c oxidase .

What are the most effective methods for isolating and characterizing the bc1 complex from N. crassa?

To effectively isolate and characterize the cytochrome bc1 complex from Neurospora crassa, researchers should employ a multi-step approach that preserves the integrity of the complex while allowing detailed analysis of its components.

Begin with careful mitochondrial isolation using differential centrifugation techniques in appropriate buffer conditions (typically containing sucrose, amino hexanoic acid, and protease inhibitors). For subsequent analysis, blue native polyacrylamide gel electrophoresis (BN-PAGE) has proven particularly valuable for studying respiratory chain complexes while maintaining their native associations. This technique separates the intact complexes based on size while preserving protein-protein interactions .

For more detailed characterization, use the first-dimension BN-PAGE followed by second-dimension SDS-PAGE, which separates individual subunits while maintaining information about their complex associations. Immunodecoration with subunit-specific antibodies can then identify the presence and relative abundance of specific components, including the Rieske protein. This approach allows researchers to determine not only whether the Rieske protein is present, but also its association with other bc1 complex subunits and with other respiratory complexes .

Spectroscopic methods can complement these approaches by assessing the functional integrity of the iron-sulfur center in the Rieske protein, while activity assays measuring electron transfer rates can evaluate functional competence of the complex.

What are the best expression systems for producing recombinant N. crassa Rieske protein?

Based on the complex nature of the Rieske protein, which requires proper folding and incorporation of an iron-sulfur cluster, heterologous expression systems that can support these post-translational modifications are essential. While no single "best" system exists, several approaches have proven successful for related Rieske proteins.

A eukaryotic expression system such as Saccharomyces cerevisiae offers advantages for expressing the N. crassa Rieske protein, as it provides the mitochondrial machinery necessary for proper folding and iron-sulfur cluster assembly. When using yeast, consider using strains with deletions in the endogenous Rieske gene to prevent formation of hybrid complexes. Expression should be driven by an inducible promoter (such as GAL1) to control expression levels, which is crucial for proper folding .

Bacterial systems like E. coli can also be employed when coupled with co-expression of iron-sulfur cluster assembly machinery. For E. coli expression, consider using specialized strains with enhanced disulfide bond formation capabilities and iron-sulfur cluster assembly systems. The protein should be expressed with a cleavable tag for purification, and expression conditions should be optimized for slow expression at lower temperatures (16-20°C) to enhance proper folding.

For either system, purification should employ gentle detergents that maintain protein stability while effectively solubilizing the membrane-associated protein. A combination of affinity chromatography followed by size exclusion chromatography in the presence of stabilizing agents has proven effective for related proteins.

How does the absence of the Rieske protein affect bc1 complex assembly and respiratory supercomplex formation?

The absence of the Rieske protein has profound effects on both bc1 complex maturation and respiratory chain organization. In deletion strains lacking the Rieske protein (ΔISP), a stable bc1 sub-complex of approximately 500 kDa forms, containing cytochrome b, cytochrome c1, core proteins 1 and 2, and subunits Qcr7p and Qcr8p. This sub-complex also contains Qcr9p and the chaperone Bcs1p, but notably lacks both the Rieske protein and the Qcr10p subunit .

This truncated complex demonstrates several critical insights into bc1 assembly:

  • The Rieske protein is not required for the formation of a stable core structure

  • Qcr10p appears to be the final subunit incorporated, requiring prior Rieske protein insertion

  • The absence of the Rieske protein completely prevents the formation of respiratory supercomplexes

The 500 kDa bc1 sub-complex found in ΔISP strains is unable to interact with cytochrome c oxidase, as evidenced by the absence of Cox6bp and Cox1p in this sub-complex region during BN-PAGE analysis. Instead, these oxidase components are found in a different region corresponding to approximately 230 kDa, likely representing the monomeric form of cytochrome c oxidase .

This indicates that the Rieske protein plays a crucial role not just in the catalytic function of the bc1 complex, but also in enabling the structural interactions necessary for respiratory supercomplex formation, which is essential for optimal electron transport chain efficiency.

What can phylogenetic analysis reveal about the evolution and conservation of the Rieske protein in Neurospora species?

Phylogenetic analysis of the Rieske protein across Neurospora species can provide valuable insights into both functional conservation and species divergence. Neurospora has been extensively studied as a model for understanding speciation and reproductive isolation, with both biological species recognition (BSR) and phylogenetic species recognition (PSR) approaches yielding comparable results in most cases .

When examining a conserved protein like the Rieske subunit across Neurospora species (including N. crassa, N. intermedia, and identified phylogenetic species PS1, PS2, and PS3), researchers can map functional conservation against established phylogenetic relationships. Studies have shown that among Neurospora species, increased genetic distance is associated with decreased reproductive success in crosses, suggesting that molecular divergence in proteins like Rieske may contribute to reproductive isolation .

The Rieske protein, being essential for respiratory function, is subject to strong selective pressure and typically shows high sequence conservation in catalytic domains while potentially exhibiting greater variation in non-catalytic regions. By comparing Rieske protein sequences across the Neurospora species complex identified through genealogical concordance (as described in Dettman et al. 2003), researchers can examine whether molecular evolution of this protein correlates with the established species boundaries .

What quantitative methods are most appropriate for studying Rieske protein incorporation into the bc1 complex?

For studying the incorporation of the Rieske protein into the bc1 complex, a combination of quantitative methodologies yields the most comprehensive results. Quantitative research approaches allow researchers to confirm hypotheses about protein incorporation rates, stoichiometry, and kinetics through numerical data analysis .

Blue native gel electrophoresis coupled with quantitative western blotting provides a powerful approach for measuring the relative abundance of the Rieske protein in different assembly intermediates. By using serial dilutions of purified proteins as standards, researchers can generate calibration curves for accurately quantifying protein levels. Image analysis software can then be used to measure band intensities, allowing statistical comparison across different experimental conditions .

Mass spectrometry-based approaches offer even greater precision. Selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) can quantify specific peptides unique to the Rieske protein, allowing absolute quantification when used with isotopically-labeled standards. This approach can detect subtle changes in protein incorporation efficiency under different experimental conditions.

For kinetic studies of Rieske protein incorporation, pulse-chase experiments using radioisotope or stable isotope labeling can track the movement of newly synthesized protein into the complex over time. This data can be fitted to mathematical models to determine rate constants for different steps in the assembly process.

These quantitative approaches should be complemented with appropriate statistical analysis methods, including:

  • ANOVA for comparing multiple experimental conditions

  • Regression analysis for examining relationships between variables

  • Principal component analysis for identifying patterns in complex datasets

  • Statistical power calculations to ensure adequate sample sizes

By combining these quantitative methodologies, researchers can move beyond descriptive observations to develop and test mechanistic models of Rieske protein incorporation .

How can researchers distinguish between direct effects of Rieske protein absence and secondary consequences?

Distinguishing between direct effects of Rieske protein absence and secondary consequences requires a carefully designed methodological approach that combines genetic manipulation with temporal analysis and complementary systems.

First, implement an inducible expression system for the Rieske protein that allows temporal control over its presence. This could utilize a galactose-inducible promoter in yeast systems or a tetracycline-responsive system in Neurospora. By tracking changes immediately following Rieske protein depletion versus those that emerge later, researchers can begin to separate primary from secondary effects .

Second, employ a comparative analysis across multiple deletion strains. By examining phenotypes in strains lacking different bc1 complex components (ΔISP, ΔQCR9, ΔBCS1), researchers can identify which effects are specific to Rieske protein absence versus general consequences of disrupted bc1 complex assembly. For example, if a phenotype appears in ΔISP but not in ΔBCS1 strains (which also lack the Rieske protein due to impaired insertion), this suggests the effect depends on the chaperone rather than the Rieske protein itself .

Third, utilize rescue experiments where the wild-type Rieske protein is reintroduced into deletion strains. Effects that are directly due to Rieske protein absence should be reversed upon complementation. Time-course analysis following reintroduction can further distinguish immediate from delayed recovery, indicating direct versus indirect relationships.

Finally, employ yeast two-hybrid or proximity labeling approaches to identify proteins that directly interact with the Rieske protein. Changes to proteins that physically interact with Rieske are more likely to represent direct effects of its absence, while changes to non-interacting proteins likely represent downstream consequences.

This multi-faceted approach combines qualitative and quantitative methodologies to establish causal relationships rather than mere correlations, allowing researchers to develop accurate models of Rieske protein function .

How does the assembly pathway of the bc1 complex in N. crassa compare to that in other model organisms?

The assembly pathway of the cytochrome bc1 complex shows both conserved and divergent features when comparing Neurospora crassa to other model organisms, particularly the well-studied Saccharomyces cerevisiae. Understanding these similarities and differences provides valuable insights into the fundamental principles governing respiratory complex assembly.

In yeast, the bc1 complex assembly begins with a core structure containing cytochrome b, the two small subunits Qcr7p and Qcr8p, followed by the addition of cytochrome c1, and the two core proteins. This creates a stable 500 kDa assembly intermediate. Subsequently, Qcr9p is incorporated, followed by the Rieske protein (requiring the Bcs1p chaperone), and finally Qcr10p. Only the fully assembled complex can form respiratory supercomplexes with cytochrome c oxidase .

The assembly pathway in N. crassa follows a similar general pattern, but with potential species-specific variations in chaperone requirements and assembly kinetics. While both organisms require specialized chaperones for Rieske protein incorporation, the specific chaperone proteins and their mechanisms may differ. Additionally, the timing and efficiency of supercomplex formation may vary between species.

These comparative studies reveal evolutionary conservation of the core assembly process while highlighting adaptations that may reflect differences in environmental conditions, metabolic requirements, or genetic background between species. The 500 kDa assembly intermediate appears to be a conserved feature, suggesting it represents a fundamental checkpoint in the bc1 complex maturation process across different fungi .

Table 1: Comparison of bc1 Complex Assembly Intermediate Components in Yeast Deletion Strains

SubunitWild TypeΔISPΔBCS1ΔQCR9ΔISP/ΔQCR9
Cytochrome bPresentPresentPresentPresentPresent
Cytochrome c1PresentPresentPresentPresentPresent
Core protein 1PresentPresentPresentPresentPresent
Core protein 2PresentPresentPresentPresentPresent
Qcr7pPresentPresentPresentPresentPresent
Qcr8pPresentPresentPresentPresentPresent
Qcr9pPresentPresentPresentAbsentAbsent
ISP (Rieske)PresentAbsentAbsentAbsentAbsent
Qcr10pPresentAbsentAbsentAbsentAbsent
Bcs1p (chaperone)N/APresentAbsentPresentPresent
Cox6bp associationYesNoNoNoNo

This table indicates key components of the cytochrome bc1 complex found in different yeast deletion strains, showing which subunits are present in the approximately 500 kDa assembly intermediate observed in each strain .

What methodological approaches are most effective for investigating the role of chaperones in Rieske protein insertion?

Investigating the role of chaperones in Rieske protein insertion requires a multi-faceted methodological approach that combines genetic, biochemical, and structural techniques to elucidate the mechanisms of this specialized process.

Genetic manipulation approaches provide the foundation for these studies. Creating a series of deletion strains (ΔBCS1, ΔISP) and conditional mutants allows researchers to examine how the absence or modification of specific chaperones affects Rieske protein incorporation. Gene complementation experiments using mutated versions of chaperone genes can identify critical domains and residues involved in the interaction with the Rieske protein .

Biochemical characterization using blue native electrophoresis followed by second-dimension SDS-PAGE with immunodecoration can visualize the composition of assembly intermediates in different chaperone mutants. This approach has successfully demonstrated that in the absence of the Bcs1p chaperone in yeast, a stable bc1 sub-complex forms that contains cytochrome b, cytochrome c1, core proteins 1 and 2, Qcr7p, Qcr8p, and Qcr9p, but lacks both the Rieske protein and Qcr10p .

Protein-protein interaction studies using techniques such as co-immunoprecipitation, crosslinking mass spectrometry, or hydrogen-deuterium exchange mass spectrometry can identify the specific contact points between chaperones and the Rieske protein. These approaches can be complemented by structural studies using cryo-electron microscopy to visualize chaperone-bound assembly intermediates.

In vitro reconstitution experiments, in which purified components are combined under controlled conditions, can test specific hypotheses about the requirements for successful Rieske protein insertion, including the roles of ATP, membrane potential, or additional cofactors in the chaperone-mediated process.

Together, these methodological approaches provide complementary perspectives on the mechanistic details of chaperone-mediated Rieske protein insertion, allowing researchers to develop comprehensive models of this critical step in bc1 complex assembly .

What are the most common challenges in expressing and purifying recombinant N. crassa Rieske protein and how can they be addressed?

Expressing and purifying recombinant Neurospora crassa Rieske protein presents several technical challenges due to its complex nature as an iron-sulfur protein and its typical membrane association. Researchers commonly encounter difficulties with protein solubility, proper folding, iron-sulfur cluster incorporation, and maintaining stability during purification.

One significant challenge is achieving proper folding and iron-sulfur cluster incorporation. The Rieske protein requires specific cellular machinery for correct assembly of its [2Fe-2S] cluster. To address this, researchers should consider using expression systems with intact iron-sulfur cluster assembly pathways, such as specialized E. coli strains co-expressing iron-sulfur cluster assembly proteins or eukaryotic systems like yeast. Additionally, supplementing growth media with iron and controlling oxygen levels during expression can enhance proper cluster formation .

Membrane association presents another hurdle, as the Rieske protein contains a transmembrane domain. To overcome solubility issues, researchers can express truncated versions lacking the transmembrane domain or utilize appropriate detergents during extraction and purification. Detergent screening is often necessary to identify conditions that maintain protein stability while effectively solubilizing the protein. Mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin often prove effective for retaining structural integrity of membrane proteins .

Protein degradation during expression and purification is another common challenge. This can be mitigated by:

  • Using protease-deficient expression strains

  • Including protease inhibitors throughout purification

  • Maintaining samples at 4°C during all purification steps

  • Minimizing the time between cell lysis and completion of purification

  • Including stabilizing agents like glycerol in all buffers

Heterogeneity in iron-sulfur cluster content can complicate analysis. Researchers should implement quality control steps such as UV-visible spectroscopy and electron paramagnetic resonance (EPR) to verify the presence and integrity of the iron-sulfur cluster. Only preparations with consistent spectral properties should be used for subsequent experiments.

By anticipating these challenges and implementing appropriate methodological solutions, researchers can improve the likelihood of obtaining functional recombinant Neurospora crassa Rieske protein suitable for structural and functional studies .

How can researchers interpret contradictory data when studying bc1 complex assembly in N. crassa?

When confronted with contradictory data regarding bc1 complex assembly in Neurospora crassa, researchers should implement a systematic approach combining multiple methodologies to resolve inconsistencies and develop a more accurate understanding of the assembly process.

First, carefully evaluate experimental methodologies that produced contradictory results. Different solubilization conditions, detection methods, or sample preparation techniques can significantly impact observations about complex assembly. For example, harsher detergents might disrupt certain protein-protein interactions, creating artificial assembly intermediates. Researchers should directly compare results obtained using different methodologies on identical samples to assess method-dependent effects .

Second, consider the temporal dimension of assembly. Contradictory data might reflect different stages of a dynamic assembly process rather than fundamentally incompatible models. Time-course experiments can reveal the sequence of events and help reconcile apparently contradictory snapshots of the assembly process. This approach has been valuable in understanding that the bc1 complex assembly proceeds through distinct intermediate stages with different subunit compositions .

Fourth, carefully examine biological variables. Contradictory data might reflect genuine biological differences rather than errors. Factors like growth conditions, genetic background, or mitochondrial membrane composition can influence complex assembly. Standardizing these variables or systematically exploring their effects can help explain apparent contradictions.

Finally, develop quantitative models that can account for seemingly contradictory observations. Mathematical modeling of assembly pathways can sometimes reconcile apparently conflicting data by revealing how different experimental conditions might shift equilibria or rate-limiting steps in the assembly process.

This multi-faceted approach transforms contradictory data from a problem into an opportunity for developing more sophisticated and comprehensive models of bc1 complex assembly in Neurospora crassa .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.