Recombinant Neurospora crassa Cytochrome b mRNA maturase bI3 (bI3)

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence and Functional Domains

The bI3 sequence (UniProt ID: P0CY43) includes conserved motifs critical for RNA binding and catalytic activity. Notably, it retains structural homology with LAGLIDADG-type endonucleases but has evolved to bind RNA instead of DNA. Key regions include:

  • RNA-binding surface: Interacts with the minor groove of group I intron RNA (P4–P6 and P5ab domains) .

  • Endonuclease active site: Compromised due to a lysine residue replacing catalytic groups, rendering it inactive for DNA cleavage .

Mechanism of Action

bI3 facilitates the splicing of group I introns in mitochondrial RNA by forming a ribonucleoprotein (RNP) complex with nuclear-encoded cofactors like Mrs1p. This complex stabilizes the intron structure and promotes catalytic activity:

  1. RNA binding: bI3 binds the minor groove of the intron, positioning it for splicing .

  2. Cofactor interaction: Mrs1p binds independently to the intron, and both proteins assemble into a 420 kDa RNP complex .

Dependence on Nuclear Cofactors

In S. cerevisiae, the splicing of cob-bi3 intron requires both bI3 and Mrs1p. Disruption of either component severely impairs intron excision, leading to reduced cytochrome b levels and respiratory dysfunction .

Transition from Endonuclease to Maturase

bI3 evolved from a DNA-binding homing endonuclease through mutations that redirected its nucleic acid binding specificity:

  • Structural conservation: Retains a global architecture similar to LAGLIDADG endonucleases .

  • Groove specificity switch: Shifted from recognizing DNA major grooves to RNA minor grooves, enabling RNA splicing .

  • Active site inactivation: A lysine substitution in the catalytic site abolished endonuclease activity, favoring RNA-binding function .

Horizontal Transmission and Functional Co-option

Group I introns often encode maturases to ensure their own splicing. In N. crassa, bI3 likely originated from a DNA endonuclease that invaded the cob gene. Subsequent mutations rendered it dependent on RNA binding, securing its role in intron excision .

Experimental Models and Compensation Mechanisms

Studies in S. cerevisiae revealed bypass mechanisms for splicing defects caused by mutations in the cob gene:

MechanismEffect
Overexpression of MRS3/MRS2Partial restoration of splicing via increased Mg²⁺ availability .
Intron deletionComplete bypass of bi2 splicing defects .
Suppressor mutations in LeuRSRescue of bI4 maturase-deficient splicing in S. cerevisiae .

Data from studies on cob intron splicing defects .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
bI3; cobi3; NCU16015; Cytochrome b mRNA maturase bI3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-477
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
bI3
Target Protein Sequence
MRLLKSHPLLKLVNSYLIDASQPSNISYLWNFGSLLACCLIIQIVTGVTLAMHYSPNVLE AFNSIEHIMRDVNNGWLVRYLHSNTASAFFFLVYLHIGRGMYYGSYRAPRTLVWAIGTVI LILMMATAFLGYVLPYGQMSLWGATVITNLISAIPWIGQDIVESKIITLIINLSFIAILF SIVVVYYYILLHVNFSSNLPTIGVIHQNALKKSNKALRLDKQEYISIPSSFLAFLAGLVD GDGYIQVTKTSKGFIAIKLVISLHLEDLSILEYIHSVLKIGKINIYKDLRSPTCKLVINK TDLQEILFPLLMYNKIFFLTNTRADQFNLAMYIFKNDIKMYNQIPDNTPAVFEIPKNPID YTLLPFFKNWIVGFTCSEGSFFIKSNNDGCFQLKQRIHTNLFEAFKLMFNTNRKIDTTNN FNQFGVSSKSDIQKVINFFSFSGLHPLVGLKYIQYIKWLNNLRESLRYSTLNYPDAK
Uniprot No.

Target Background

Function
Mitochondrial mRNA maturase essential for splicing intron 3 of the cytochrome b (cob) gene, containing its own coding sequence.
Database Links

KEGG: ncr:NCU16015

Protein Families
Cytochrome b family; LAGLIDADG endonuclease family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of cytochrome b mRNA maturase bI3 in Neurospora crassa?

The bI3 maturase is an intron-encoded protein essential for the proper splicing of the third intron (bi3) of the cytochrome b gene in Neurospora crassa mitochondria. Similar to the well-characterized maturases in Saccharomyces cerevisiae, bI3 functions as a specific RNA splicing factor that recognizes particular RNA structures within its cognate intron. The protein binds to the precursor mRNA, facilitating the correct folding of the intron RNA into a catalytically active structure necessary for self-splicing. Without functional bI3, the bi3 intron remains unspliced, preventing the formation of mature cytochrome b mRNA and subsequently blocking the assembly of functional respiratory complex III (cytochrome bc1 complex) .

How is the activity of bI3 maturase regulated in mitochondria?

The activity of bI3 maturase appears to be regulated through multiple mechanisms:

  • Metal ion availability: Similar to S. cerevisiae maturases, bI3 activity likely depends on proper metal ion homeostasis within the mitochondria. Metal ion carriers like Mrs3 and Mrs2 have been shown to affect splicing efficiency of mitochondrial introns .

  • Protein partners: The maturase does not function in isolation but requires interaction with nuclear-encoded splicing factors. These interactions create a regulatory network that coordinates splicing with other mitochondrial processes.

  • Feedback mechanisms: Expression levels of bI3 are likely regulated through feedback mechanisms that monitor the efficiency of splicing and respiratory function .

  • Coordination with translation: The splicing process appears to be coupled with translation, as observed in yeast systems where translational activators organize gene expression by linking transcription and translation of respiratory chain components .

What expression systems are most effective for producing recombinant bI3 maturase?

Based on research with similar maturases, the following expression systems have proven effective:

Expression SystemAdvantagesLimitationsYield (approx.)
E. coli BL21(DE3)High yield, simple protocolPotential misfolding, lack of mitochondrial-specific modifications5-10 mg/L culture
S. cerevisiaeProper folding, native-like modificationsLower yield, more complex purification1-3 mg/L culture
Neurospora expressionMost authentic structure, natural modificationsLowest yield, most technically challenging0.5-1 mg/L culture

When expressing bI3 in heterologous systems, consider using:

  • A C-terminal His-tag for purification, positioned to minimize interference with RNA binding

  • Truncated constructs that remove potentially problematic regions if full-length expression is poor

  • Co-expression with chaperones to improve folding

  • Induction at lower temperatures (16-20°C) to enhance solubility

What assays are most reliable for measuring bI3 splicing activity in vitro?

Multiple complementary approaches should be employed:

  • RNA splicing assays: Using radiolabeled or fluorescently-labeled precursor RNAs containing the bi3 intron, the formation of spliced products can be monitored by gel electrophoresis. Critical controls include heat-denatured enzyme, non-cognate introns, and assays with known inhibitors.

  • ATP hydrolysis assays: If bI3 functions like other DEAD-box proteins such as Mss116p, ATP hydrolysis activity can be measured as an indirect indication of RNA binding and helicase activity .

  • RNA binding assays: Techniques such as electrophoretic mobility shift assays (EMSA), filter binding assays, or fluorescence anisotropy can determine the binding affinity and specificity of bI3 for its target RNA sequences.

  • RNA structural probing: Techniques like SHAPE (Selective 2′-hydroxyl acylation analyzed by primer extension) can reveal how bI3 alters RNA structure during splicing.

A comprehensive activity assessment should include multiple RNA substrates, varying reaction conditions (particularly metal ion concentrations), and comparison with known functional variants .

Which domains and motifs in bI3 are critical for RNA recognition and catalysis?

Based on studies of related maturases and DEAD-box proteins, the following domains and motifs are likely critical:

  • Helicase core: Contains conserved motifs involved in ATP binding and hydrolysis, including:

    • Motif I (Walker A): Essential for ATP binding

    • Motif II (DEAD box): Critical for ATP hydrolysis

    • Motif III (SAT): Links ATP hydrolysis to RNA unwinding activity

  • RNA-binding regions: Specific positively charged residues interact with the RNA substrate through ionic and hydrogen-bonding interactions. Critical residues likely include conserved arginines that make direct side-chain contacts with the RNA .

  • C-terminal extension: May induce bending in the bound RNA, creating a "crimped" conformation that facilitates splicing. This region also likely contains elements that help displace or sequester the opposite RNA strand during unwinding .

Mutation studies with similar proteins indicate that variants of motif III (such as FAT, GGT, LCT, and SST) can maintain functionality, while others (AAA) severely impair activity. This suggests some flexibility in certain conserved regions while maintaining critical functional aspects .

How do mutations in the bi3 intron affect recognition and splicing by bI3 maturase?

Mutations in the bi3 intron can have various effects on bI3 maturase activity:

  • Mutations at splice sites: Alterations near the 5' or 3' splice junctions can prevent proper recognition and positioning of the maturase, leading to complete splicing defects.

  • Internal guide sequence mutations: Changes in the internal guide sequence, which pairs with the 5' exon, can significantly impair splice site recognition. This is similar to what has been observed with the G143A mutation in certain fungi, which affects splicing by disrupting this pairing .

  • Core structure mutations: Alterations that disrupt the folding of catalytic core elements can prevent proper splicing even if bI3 binding is maintained.

  • Compensatory mutations: Some mutations can be rescued by secondary mutations that restore base-pairing or structural elements, providing valuable information about RNA structure-function relationships .

How does bI3 maturase function compare between Neurospora crassa and other fungal species?

While specific comparative data for N. crassa bI3 is limited in the provided search results, insights can be drawn from studies of related systems:

SpeciesMaturase PropertiesIntron CharacteristicsRegulatory Features
Neurospora crassa (bI3)Likely functions as a specific RNA chaperoneGroup I intron in cytochrome b genePotentially regulated by metal homeostasis
S. cerevisiae (bi3)Functions as a specific RNA chaperoneGroup I intron in COB gene (cytochrome b)Requires nuclear-encoded splicing factors like Mrs1; affected by metal ion carriers (Mrs3, Mrs2)
B. cinereaSimilar to yeast maturases with potential differences in metal ion dependenciesContains introns subject to splicing defects with G143A mutationMrs3 from B. cinerea can complement yeast mutants, suggesting conserved mechanisms

The functional conservation across species suggests that the basic mechanisms of maturase-assisted splicing are ancient and fundamentally important for mitochondrial gene expression in fungi .

What nuclear-encoded factors influence bI3 activity in N. crassa mitochondria?

By analogy with S. cerevisiae, several types of nuclear-encoded factors likely influence bI3 activity:

  • Metal ion carriers: Proteins similar to yeast Mrs2 and Mrs3 that transport metal ions into mitochondria are likely important, as these have been shown to affect splicing efficiency of mitochondrial introns .

  • RNA helicases: DEAD-box proteins that function as general RNA chaperones, analogous to Mss116p in yeast, may assist bI3 by remodeling RNA structures during the splicing process .

  • Translation activators: Proteins similar to yeast Cbs1, Cbs2, and Cbp6 that activate translation of cytochrome b mRNA may coordinate splicing and translation processes .

  • RNA processing factors: General RNA processing factors like those in the mitochondrial degradosome (mtEXO) likely influence mRNA stability and may affect the availability of pre-mRNA substrates for bI3 .

How can bI3 be leveraged for studying mitochondrial gene expression coordination?

The bI3 maturase offers a valuable tool for exploring how mitochondrial gene expression processes are coordinated:

  • Transcription-splicing-translation coupling: By creating conditional bI3 variants, researchers can probe how disruption of splicing affects upstream (transcription) and downstream (translation) processes. This can reveal mechanisms of process coupling similar to those observed in yeast, where translational activators participate in organizing gene expression by coupling mRNA transcription and translation .

  • Mitochondrial RNA quality control: Studying how cells respond to defective bI3 can illuminate RNA surveillance pathways that detect and eliminate improperly processed transcripts. This connects to observations in yeast where the mitochondrial degradosome (mtEXO) functions in RNA turnover and surveillance .

  • Assembly factor interactions: bI3 likely functions within a network of protein-protein interactions that coordinate the production of respiratory chain components. Characterizing these interactions can reveal how mitochondria ensure stoichiometric assembly of multi-subunit complexes .

  • Metal homeostasis effects: The apparent dependency of splicing on metal ion carriers presents opportunities to study how metabolic conditions and metal availability influence gene expression post-transcriptionally .

What compensatory mechanisms exist when bI3 function is impaired?

Based on studies of similar systems, several compensatory mechanisms may exist:

  • Increased expression of metal ion carriers: Overexpression of metal ion transporters like Mrs3 has been shown to compensate for defective splicing in yeast with the G143A mutation. This suggests that enhanced metal availability can partially overcome certain splicing defects .

  • Upregulation of general RNA chaperones: Increased expression of general RNA chaperones may partially compensate for specific maturase defects by promoting alternative folding pathways for the intron RNA.

  • Altered mitochondrial translation: Changes in translation efficiency through modulation of translational activators may help compensate for reduced mature mRNA levels resulting from splicing defects .

  • Import of cytosolic isoforms: For some respiratory chain components, nuclear-encoded isoforms might be upregulated and imported into mitochondria to compensate for deficiencies in mitochondrially-encoded proteins.

The study by Ding et al. showed that high-copy-number expression of MRS3 restored cytochrome b levels to 40-50% of wild-type in yeast with splicing defects, demonstrating the potential for compensatory mechanisms to partially rescue mitochondrial function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.