Recombinant Neurospora crassa Cytochrome c oxidase subunit 2 (cox-2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
cox-2; cox2; oxi1; NCM018; NCU16028; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II; Cytochrome c oxidase subunit Cox2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
cox-2
Target Protein Sequence
MGLLFNNLIMNFDAPSPWGIYFQDSATPQMEGLVELHDNIMYYLVVILFGVGWILLSIIR NYISTKSPISHKYLNHGTLIELIWTITPAVILILIAFPSFKLLYLMDEVSDPSMSVLAEG HQWYWSYQYPDFLDSNDEFIEFDSYIVPESDLEEGALRMLEVDNRVILPELTHVRFIITA GDVIHSFAVPSLGVKCDAYPGRLNQVSVFINREGVFYGQCSEICGILHSSMPIVIESVSL EKFLTWLEEQ
Uniprot No.

Target Background

Function

Recombinant Neurospora crassa Cytochrome c oxidase subunit 2 (COX-2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (CIV). These complexes cooperatively transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center of COX2 and heme a of COX1 to the binuclear center (BNC) in COX1, composed of heme a3 and CuB. The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Database Links

KEGG: ncr:NCU16028

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the distinction between Cytochrome c oxidase subunit 2 (cox-2) and Cyclooxygenase-2 (COX-2)?

Cytochrome c oxidase subunit 2 (cox-2) and Cyclooxygenase-2 (COX-2) are entirely different proteins that happen to share similar abbreviations, which often causes confusion in the literature. Cytochrome c oxidase subunit 2 is a mitochondrial protein component of Complex IV in the electron transport chain, while Cyclooxygenase-2 is an inducible enzyme involved in inflammation and prostaglandin synthesis. The latter is the target of nonsteroidal anti-inflammatory drugs (NSAIDs) . In literature searches, researchers should be careful to distinguish studies about mitochondrial cox-2 from those about inflammatory COX-2.

What expression systems are most effective for producing recombinant Neurospora crassa proteins?

For recombinant expression of Neurospora crassa proteins, including Cytochrome c oxidase subunit 2, researchers typically employ molecular cloning techniques using restriction enzymes. Based on protocols for other Neurospora proteins, successful approaches include amplifying the target gene using PCR with primers containing appropriate restriction sites (e.g., XbaI and PacI), followed by cloning into expression vectors containing either the ccg-1 or tef-1 promoter . For visualization and tracking of the recombinant protein, fluorescent protein tags such as GFP or mCherry can be incorporated into the construct design.

How should researchers assess the functional viability of Neurospora crassa strains expressing recombinant proteins?

Assessment of strain viability and functionality after recombinant protein expression should follow established protocols for Neurospora crassa. Standard methods include:

  • Growth rate assessment: Place an inoculum on agar and monitor growth for 2 days at 30°C in darkness followed by 1 week at room temperature

  • Conidiation (asexual reproduction) evaluation: Grow slant tubes for 4-6 days until significant conidiation occurs

  • Germling fusion analysis: Harvest conidia from slant tubes and assess the ability of germlings to undergo fusion compared to wild-type strains

These parameters provide essential baseline data for determining whether expression of recombinant proteins affects normal cellular functions.

How does the promoter choice affect expression levels of recombinant Neurospora crassa Cytochrome c oxidase subunit 2?

The choice between ccg-1 and tef-1 promoters significantly impacts expression patterns of recombinant proteins in Neurospora crassa. For optimal expression of mitochondrial proteins like Cytochrome c oxidase subunit 2, construct design should incorporate appropriate promoter elements. Based on protocols for other Neurospora proteins, researchers can amplify native promoter regions (e.g., 1387 bp upstream of the start codon) using targeted primers with appropriate restriction enzyme sites, then ligate this into the expression plasmid . For recombinant cox-2 expression, comparative analysis between native and heterologous promoters is recommended to determine which provides expression levels most suitable for your specific experimental objectives.

What role does NF-κB signaling play in regulating expression of mitochondrial proteins in Neurospora crassa?

While NF-κB is well-established as a regulator of inflammatory Cyclooxygenase-2 (COX-2) expression in mammalian systems , its role in regulating mitochondrial gene expression in fungi like Neurospora crassa remains less characterized. In mammalian systems, NF-κB regulates neuronal COX-2 gene expression through binding to κB sites in the promoter region . The promoter-distal NF-κB 1-site has been shown to be crucial for COX-2 promoter activity . When investigating regulatory mechanisms for Neurospora crassa cox-2, researchers should examine whether analogous transcription factor binding sites exist in the promoter region of the mitochondrial gene, though direct homology to mammalian systems should not be assumed.

What methodological approaches best resolve the localization patterns of recombinant Cytochrome c oxidase subunit 2 in Neurospora crassa?

For precise localization studies of mitochondrial proteins in Neurospora crassa, fluorescent protein fusion techniques offer high-resolution visualization capabilities. Based on established protocols:

  • Create N-terminal or C-terminal fusions with fluorescent reporters (GFP or mCherry) under appropriate promoter control

  • For mitochondrial proteins like cox-2, ensure the fusion construct preserves mitochondrial targeting sequences

  • When analyzing secretory pathway proteins, N-terminal fusion to red fluorescent protein can be particularly effective

  • For co-localization studies, combine reporters with different spectral properties (e.g., GFP and mCherry)

When analyzing microscopy data, researchers should correlate localization patterns with functional assays to ensure that fluorescent tagging does not disrupt normal protein function or targeting.

What control strains should be included when studying recombinant Neurospora crassa Cytochrome c oxidase subunit 2?

Robust experimental design for recombinant cox-2 expression studies requires multiple control strains:

  • Wild-type Neurospora crassa (no genetic modification)

  • Strains expressing only the fluorescent reporter protein without cox-2 fusion

  • Strains with tagged versions of known mitochondrial proteins for localization comparison

  • If available, cox-2 deletion mutants for functional complementation studies

These controls help distinguish between effects caused by the expression system itself versus those attributable to the recombinant cox-2 protein's function or overexpression.

How can researchers address potential data contradictions in Cytochrome c oxidase activity assays?

When investigating contradictory results in Cytochrome c oxidase activity measurements, researchers should systematically evaluate:

  • Sample preparation variability: Mitochondrial isolation techniques can significantly impact enzyme activity measurements

  • Growth conditions: Temperature, media composition, and growth phase can all affect mitochondrial enzyme expression

  • Strain background effects: Genetic variations between laboratory strains may contribute to differing baseline activities

  • Assay conditions: pH, temperature, substrate concentrations, and detection methods should be standardized across experiments

For reconciling contradictory findings, researchers should perform side-by-side comparisons using identical protocols and multiple biological replicates to identify the source of variation.

How does understanding MAP kinase signaling in Neurospora crassa inform research on mitochondrial protein expression?

MAP kinase signal transduction pathways play critical roles in Neurospora crassa cellular processes, including germling fusion and potentially mitochondrial function regulation. Key components of this pathway include NRC-1, MEK-2, and MAK-2, along with the scaffold protein HAM-5 . When designing experiments to study recombinant cox-2 expression, researchers should consider:

  • Potential regulatory relationships between MAP kinase signaling and mitochondrial gene expression

  • How cellular stress responses mediated by MAP kinases might affect mitochondrial function

  • Whether experimental manipulation of MAP kinase pathways alters cox-2 expression or function

Understanding these regulatory relationships may provide insights into coordinated cellular responses that integrate mitochondrial activity with other cellular processes.

What are the implications of constitutive versus inducible expression systems for studying mitochondrial proteins?

The distinction between constitutive and inducible expression has significant implications for mitochondrial protein studies. Research on the inflammatory COX-2 enzyme has demonstrated fundamentally different regulatory mechanisms between constitutive and inducible expression . For mitochondrial cox-2 studies, researchers should consider:

  • Whether native cox-2 expression is constitutive or regulated in response to metabolic or environmental signals

  • How artificial constitutive expression might disrupt normal mitochondrial stoichiometry

  • The potential for inducible systems to allow temporal control over recombinant protein expression

  • Whether expression levels match physiological conditions or create artifacts due to overexpression

For studies requiring physiologically relevant conditions, carefully regulated inducible systems may provide advantages over constitutive promoters by allowing experimental control over expression timing and levels.

How might targeting transcriptional regulation of Cytochrome c oxidase inform development of mitochondrial-targeted interventions?

Research on inflammatory COX-2 has demonstrated that targeting transcriptional regulation rather than enzyme activity directly can potentially dissociate therapeutic benefits from side effects . By analogy, studies of mitochondrial cox-2 transcriptional regulation in Neurospora crassa might inform approaches to modulate mitochondrial function in various organisms. Researchers should investigate:

These approaches could provide insights applicable beyond Neurospora to broader questions of mitochondrial regulation in health and disease.

What methodological advances are needed to better characterize the assembly and function of mitochondrial protein complexes in Neurospora crassa?

Current techniques for studying mitochondrial protein complexes have limitations that future methodological developments should address:

  • Improved in vivo imaging techniques with higher temporal and spatial resolution

  • Methods for tracking protein-protein interactions within intact mitochondria

  • Approaches for correlating structural assembly with functional activity measurements

  • Development of fungal-specific antibodies against mitochondrial complex components

  • Standardized protocols for isolating functional mitochondrial complexes while preserving native interactions

Addressing these methodological challenges would significantly advance understanding of mitochondrial biology in Neurospora crassa and potentially provide model systems relevant to mitochondrial diseases in humans.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.