Recombinant Neurospora crassa Cytochrome c oxidase subunit 3 (cox-3)

Shipped with Ice Packs
In Stock

Description

Gene Structure and Protein Characteristics

The cox-3 gene in N. crassa is located downstream of the small rRNA gene within a cluster of tRNA genes and is transcribed on the same strand as these regulatory elements . Key features include:

FeatureDescriptionReference
Gene LocationDownstream of small rRNA gene; flanked by GC-rich palindromic sequences.
Protein Length269 amino acids.
Tryptophan Codons8 tryptophans, all encoded by UGA (unlike nuclear UGA stop codons).
HydrophobicityHigh hydrophobicity, consistent with membrane integration.

The use of UGA for tryptophan synthesis highlights a unique mitochondrial translation mechanism conserved across eukaryotes .

Functional Role in Cytochrome c Oxidase

Cox-3 is part of the catalytic core of COX (Complex IV), which transfers electrons from cytochrome c to oxygen, generating a proton gradient for ATP synthesis. While cox-3 lacks prosthetic groups, it is critical for stabilizing the heme a-Cu₃B center in cox-1 and modulating oxygen access .

Key Functional Interactions

Cox-3 interacts with other COX subunits and assembly factors, as shown in protein interaction networks:

Interaction PartnerRole in COX Assembly/FunctionInteraction Score
Cox-1Forms the catalytic core with cox-3 and cox-2; coordinates heme a.0.999
Cox-2Binds Cu₃A center; receives electrons from cytochrome c.0.999
Cox-4, Cox-5a, Cox-6Nuclear-encoded subunits stabilizing the COX structure.0.999
Shy1Assembly factor involved in early COX biogenesis.N/A (qualitative)

These interactions highlight cox-3’s role in maintaining structural integrity and facilitating electron transport .

Evolutionary Conservation

Cox-3 exhibits strong homology with orthologs in other eukaryotes, reflecting conserved functional roles:

OrganismHomology to N. crassa Cox-3Protein LengthKey Functional Domains
Saccharomyces cerevisiae (Cox3p)53% amino acid identity269 aaHydrophobic transmembrane regions
Homo sapiens (COX3)47% amino acid identity261 aaMembrane-embedded core structure

The hydrophobic transmembrane domains are evolutionarily conserved, underscoring cox-3’s role in membrane integration .

Research Findings and Implications

  • Assembly Regulation: Cox-3 interacts with assembly factors like Shy1 and Cox14, which coordinate cox-1 translation and COX biogenesis .

  • Mitochondrial Translation: The cox-3 mRNA lacks untranslated regions (UTRs) critical for translational activation, unlike cox-1 and cox-2 in yeast . This suggests distinct regulatory mechanisms in N. crassa.

  • Disease Relevance: Mutations in COX subunits or assembly factors cause human mitochondrial disorders; cox-3 studies may inform therapeutic strategies.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on your purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein orders are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoted for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is dependent on several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
cox-3; cox3; oxi2; NCM012; NCU16003; Cytochrome c oxidase subunit 3; Cytochrome c oxidase polypeptide III; Cytochrome c oxidase subunit Cox3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
cox-3
Target Protein Sequence
MTNLIRSNFQDHPFHLVSPSPWPLNTSVCLLNLTTTGALSMHNFNNIHYLYYIALIGLVS AMFLWFRDIISEGTFLGDHTLAVQRGLNLGIILFIVSEALFFLAIFWAFFHSALTPTVEL GAQWPPIGIEPVNPFELPLLNTVILLSSGATITYAHHALIKGEREGALYGSIATILLAII FTGFQGVEYSVSSFTISDGAFGTCFFFSTGFHGIHVIIGTIFLAVALWRIFAYHLTDNHH VGFEGGILYWHFVDVVWLFLYISVYYWGS
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 3 (cox-3) is a crucial component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain. This chain drives oxidative phosphorylation, a fundamental process that generates energy for cellular functions. The respiratory chain consists of three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work in concert to transfer electrons derived from NADH and succinate to molecular oxygen, establishing an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase specifically catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of Cox2 and heme A of Cox1 to the active site in Cox1. This site is a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC then reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Database Links

KEGG: ncr:NCU16003

Protein Families
Cytochrome c oxidase subunit 3 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the genetic structure and location of the cox-3 gene in Neurospora crassa?

The cytochrome oxidase subunit III (cox-3) gene in Neurospora crassa is located in the mitochondrial genome, positioned downstream from the small rRNA gene within a cluster of tRNA genes. The gene is coded by the same strand as the tRNA and rRNA genes, and is distinctively flanked by GC-rich palindromic DNA sequences that are highly conserved in N. crassa mitochondria . The coding sequence predicts a protein 269 amino acids in length, containing 8 tryptophan residues, all of which are encoded by the UGA codon . This gene organization reflects the unique structural and regulatory features of mitochondrial genes in filamentous fungi.

How does N. crassa cox-3 differ from mammalian homologs?

The N. crassa cox-3 protein displays several notable differences compared to its mammalian counterparts:

What is the functional significance of cytochrome c oxidase in Neurospora crassa metabolism?

Cytochrome c oxidase functions as the terminal enzyme of the electron transport chain in mitochondria, catalyzing the reduction of molecular oxygen to water using electrons transferred from cytochrome c. In N. crassa, this enzyme plays several critical roles:

  • Energy production: As the final electron acceptor in oxidative phosphorylation, it drives ATP synthesis essential for cellular metabolism.

  • Redox homeostasis: Maintains cellular redox balance during various metabolic states.

  • Stress response: Functions in adaptation to environmental changes, particularly oxygen availability fluctuations.

  • Growth regulation: Supports the rapid hyphal extension characteristic of filamentous fungi through efficient energy production.

The cox-3 subunit contributes to proton pumping and maintenance of the enzyme's catalytic core, with its hydrophobic structure facilitating proper membrane embedding and function in the mitochondrial inner membrane .

How do post-translational modifications affect the structure and function of N. crassa cox-3?

The cytochrome c oxidase complex in N. crassa undergoes several post-translational modifications that significantly impact its function. While research has specifically identified myristoylation of subunit 1 through an unusual amide linkage at an internal lysine (Lys-324) , similar modifications may occur in cox-3. These modifications likely serve multiple purposes:

  • Membrane anchoring: Fatty acylation enhances hydrophobicity, potentially stabilizing the protein within the mitochondrial inner membrane.

  • Protein-protein interactions: Modifications may facilitate proper assembly of the multi-subunit complex.

  • Enzymatic activity modulation: Strategic modifications can alter local protein conformation, affecting electron transfer kinetics or oxygen binding affinity.

  • Regulatory control: PTMs may serve as regulatory switches responding to metabolic conditions.

Researchers investigating cox-3 modifications should consider employing mass spectrometry-based approaches to identify modification sites, coupled with site-directed mutagenesis to assess their functional significance .

What mechanisms regulate the expression and assembly of cox-3 in the mitochondrial membrane?

The expression and assembly of cox-3 in N. crassa involves a sophisticated regulatory network operating at multiple levels:

  • Transcriptional regulation: Mitochondrial transcription factors respond to cellular energy demands and oxygen availability.

  • RNA processing: The cox-3 transcript undergoes processing within a polycistronic transcript containing neighboring tRNA genes .

  • Translation regulation: Specialized mitochondrial ribosomes with unique tRNA recognition properties accommodate the non-canonical codon usage (UGA coding for tryptophan) .

  • Assembly factors: Dedicated chaperones facilitate the integration of the hydrophobic cox-3 protein into the inner membrane and coordinate its assembly with other subunits.

  • Quality control: Proteases selectively degrade improperly folded or unassembled proteins to maintain mitochondrial proteostasis.

How does the genetic tractability of N. crassa facilitate studies of mitochondrial proteins compared to other model organisms?

Neurospora crassa offers distinct advantages for studying mitochondrial proteins like cox-3:

  • Genetic manipulation: N. crassa provides a minimal Polycomb repression system that enables genetic studies that can be challenging in plant and animal systems . This facilitates the creation of knockouts, point mutations, and tagged variants.

  • Homologous recombination efficiency: N. crassa possesses efficient homologous recombination machinery involving genes like mei-3 (RAD51 homolog), mus-11 (RAD52 homolog), mus-48 (RAD55 homolog) and mus-49 (RAD57 homolog) . This enables precise genome editing techniques.

  • Haploid genetics: The predominantly haploid nature of N. crassa simplifies genetic analyses by allowing direct phenotypic manifestation of mutations.

  • Growth characteristics: Rapid growth and the ability to culture on defined media facilitate biochemical and physiological studies.

  • Mitochondrial segregation: The unique pattern of mitochondrial inheritance in N. crassa provides opportunities to study organelle segregation and heteroplasmy.

These advantages make N. crassa an excellent model for studying essential mitochondrial proteins like cytochrome c oxidase subunits, particularly for questions related to assembly, function, and genetic regulation .

What are the optimal protocols for expressing recombinant N. crassa cox-3 in heterologous systems?

Expressing recombinant N. crassa cox-3 presents unique challenges due to its mitochondrial origin, hydrophobic nature, and non-standard genetic code. The following methodological approach is recommended:

  • Codon optimization: Modify the cox-3 gene sequence to match the codon usage of the expression host, particularly changing UGA codons (which encode tryptophan in N. crassa mitochondria) to the standard tryptophan codon UGG to prevent premature translation termination .

  • Expression system selection:

    • Bacterial systems: Use specialized E. coli strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3))

    • Yeast systems: S. cerevisiae or P. pastoris often provide better membrane protein folding

    • Cell-free systems: For avoiding aggregation and toxicity issues

  • Fusion partners: Incorporate solubility-enhancing tags (e.g., MBP, SUMO) with careful positioning to avoid disrupting membrane topology.

  • Membrane targeting: Include appropriate signal sequences to direct the protein to the host's membrane system.

  • Expression conditions: Lower induction temperatures (16-20°C) and reduced inducer concentrations often improve membrane protein folding.

  • Detergent screening: Systematic evaluation of detergents for extraction (typically starting with mild non-ionic detergents like DDM or LMNG).

Tracking expression through methods like Western blotting with cox-3 specific antibodies or epitope tags is essential for optimizing these conditions for your specific experimental goals.

How can researchers effectively purify and reconstitute functional recombinant cox-3 for structural studies?

Purification and reconstitution of functional recombinant cox-3 requires careful attention to maintaining protein stability and native conformation:

  • Solubilization optimization:

    • Screen detergents systematically (from mild to harsh)

    • Test detergent concentration, temperature, and incubation time

    • Consider lipid-detergent mixed micelles to enhance stability

  • Purification strategy:

    • Affinity chromatography using carefully positioned tags

    • Size exclusion chromatography to separate different oligomeric states

    • Ion exchange chromatography for further purification

  • Reconstitution into membrane mimetics:

    • Proteoliposomes: Using lipid compositions mimicking mitochondrial inner membrane

    • Nanodiscs: For defined membrane environments and structural studies

    • Amphipols: For enhanced stability during structural analyses

  • Functional verification:

    • Spectroscopic assays to confirm heme incorporation

    • Oxygen consumption measurements to verify catalytic activity

    • Proton pumping assays to confirm vectorial transport

Detergent TypeRecommended ConcentrationAdvantagesLimitations
DDM0.5-1% for extraction, 0.05% for purificationGood for initial extractionMay dissociate protein complexes
LMNG0.1% for extraction, 0.01% for purificationExcellent stabilityExpensive, difficult to remove
Digitonin0.5-1%Preserves native interactionsVariable quality between batches
GDN0.1%Enhanced stability for complexesLimited commercial availability

For structural studies, cryo-electron microscopy has proven particularly valuable for membrane proteins like cytochrome c oxidase, allowing visualization in a near-native lipid environment.

What strategies can be employed to study the assembly of cox-3 into the cytochrome c oxidase complex?

Investigating the assembly of cox-3 into the functional cytochrome c oxidase complex requires multifaceted approaches:

  • Fluorescent protein tagging:

    • C-terminal tagging with small fluorescent proteins

    • Time-lapse microscopy to track incorporation into mitochondria

    • FRET-based approaches to monitor protein-protein interactions

  • Inducible expression systems:

    • Regulate cox-3 expression to synchronize assembly processes

    • Pulse-chase experiments with temporally controlled expression

  • Complex isolation techniques:

    • Blue Native PAGE to separate intact respiratory complexes

    • Affinity purification of partially assembled intermediates

    • Mass spectrometry to identify assembly factors

  • Genetic approaches:

    • Systematic deletion of candidate assembly factors

    • Site-directed mutagenesis of putative interaction sites

    • Suppressor screens to identify genetic interactions

  • In vitro reconstitution:

    • Stepwise addition of purified components

    • Monitoring assembly by biophysical techniques (e.g., light scattering)

These approaches can reveal the temporal sequence of assembly, identify critical interaction domains, and characterize the role of dedicated assembly factors in ensuring proper integration of cox-3 into the complete cytochrome c oxidase complex.

How should researchers interpret contradictory results in cox-3 functional studies?

When encountering contradictory results in cox-3 functional studies, consider this systematic approach:

  • Experimental context evaluation:

    • Growth conditions: N. crassa exhibits different respiratory profiles under varying carbon sources and oxygen tensions

    • Developmental stage: Expression and function may vary between conidia, germinating conidia, and mature hyphae

    • Strain background: Genetic variations between laboratory strains can impact mitochondrial function

  • Methodological considerations:

    • Protein preparation: Detergent choice significantly impacts membrane protein stability and activity

    • Assay conditions: pH, temperature, and ionic strength affect enzymatic measurements

    • Measurement techniques: Different approaches (polarography, spectroscopy, etc.) may yield varying results

  • Data interpretation framework:

    • Establish clear positive and negative controls for each experimental system

    • Quantify variability through sufficient biological and technical replicates

    • Consider integrating multiple complementary techniques to verify findings

  • Reconciliation strategies:

    • Identify condition-dependent effects that may explain differences

    • Examine whether contradictions reflect true biological complexity rather than error

    • Design decisive experiments specifically targeting the contradictory results

The seemingly contradictory data may reflect the complex regulatory mechanisms controlling cytochrome c oxidase activity in response to environmental conditions, rather than experimental errors.

What are common pitfalls in analyzing the post-translational modifications of cox-3 and how can they be avoided?

Analysis of post-translational modifications (PTMs) on cox-3 presents several challenges:

  • Common pitfalls:

    • Sample preparation artifacts: Harsh conditions can remove labile modifications

    • Incomplete coverage: Hydrophobic peptides may be underrepresented in mass spectrometry

    • Modification heterogeneity: Subpopulations with different modification patterns

    • False positives: Non-enzymatic modifications occurring during processing

  • Recommended approaches:

    • Multiple proteases: Use complementary enzymes beyond trypsin to improve sequence coverage

    • Enrichment strategies: Apply PTM-specific enrichment methods before analysis

    • Orthogonal validation: Confirm mass spectrometry findings with antibody-based or metabolic labeling approaches

    • Quantitative analysis: Determine stoichiometry of modifications at each site

  • Technical considerations:

    • Gentle extraction: Use conditions that preserve native modifications

    • Direct mitochondrial isolation: Minimize processing steps that could alter modification state

    • Control samples: Include appropriate controls to distinguish biological modifications from artifacts

The unusual myristoylation identified on subunit 1 of cytochrome c oxidase in N. crassa (at Lys-324) suggests that non-canonical modifications may also occur in cox-3, requiring careful analytical approaches to detect and characterize accurately .

How can researchers effectively compare cox-3 function across different strains of Neurospora or between different fungal species?

Comparative analysis of cox-3 function across different Neurospora strains or fungal species requires standardized methodologies:

  • Experimental standardization:

    • Growth conditions: Standardize media composition, temperature, and growth phase

    • Sample preparation: Use identical protocols for mitochondrial isolation

    • Activity measurements: Apply consistent assay conditions and normalization methods

  • Comparative framework:

    • Sequence alignment: Identify conserved and variable regions between homologs

    • Structural modeling: Map variations onto predicted structures to assess functional implications

    • Evolutionary analysis: Consider phylogenetic relationships when interpreting differences

  • Cross-species expression studies:

    • Heterologous expression: Express variant cox-3 proteins in a common background

    • Chimeric proteins: Create domain swaps to identify functional regions

    • Complementation analysis: Test ability of variants to rescue cox-3 deficient strains

  • Integrated data analysis:

    • Multi-omics integration: Combine proteomics, transcriptomics, and functional data

    • Statistical approaches: Apply appropriate statistical methods for multi-species comparisons

    • Visualization tools: Develop clear visualization of complex comparative data

Research has shown that while core functions are conserved, N. crassa cox-3 exhibits distinctive features compared to homologs in yeast (53% similarity) and humans (47% similarity), reflecting adaptation to specific ecological niches and metabolic requirements .

What emerging technologies might advance our understanding of N. crassa cox-3 structure and function?

Several cutting-edge technologies hold promise for revealing new insights about N. crassa cox-3:

  • Cryo-electron tomography: Visualizing cox-3 in its native mitochondrial membrane context without extraction, potentially revealing native arrangements and interactions.

  • Single-particle cryo-EM: Recent advances enable structural determination of membrane proteins at near-atomic resolution, potentially revealing the precise positioning and interactions of cox-3 within the complete cytochrome c oxidase complex.

  • In-cell NMR: Developing methods to observe cox-3 dynamics directly within living cells, capturing conformational changes during catalysis.

  • Proximity labeling approaches: Technologies like APEX2 or BioID fused to cox-3 can identify transient interaction partners in vivo, revealing the complete interactome.

  • Long-read sequencing: Application to mitochondrial transcriptomics could reveal complex processing and regulatory events affecting cox-3 expression.

  • CRISPR-based mitochondrial genome editing: Emerging techniques for precise modification of mitochondrial genes could enable systematic structure-function studies of cox-3 in vivo.

  • Microfluidic respirometry: Single-cell analysis of respiratory function could reveal population heterogeneity and dynamic responses not captured by bulk measurements.

These technologies, applied to the genetically tractable N. crassa system, could significantly advance our understanding of mitochondrial respiratory complexes.

How might research on N. crassa cox-3 inform broader questions about mitochondrial evolution and disease?

Research on N. crassa cox-3 has significant implications for understanding fundamental aspects of mitochondrial biology:

  • Evolutionary insights:

    • The unique genetic code features of N. crassa mitochondria (UGA coding for tryptophan) provide insights into the evolution of the mitochondrial genetic code

    • Comparative studies of cox-3 structure across species illuminate adaptation of respiratory complexes to different ecological niches

    • Post-translational modifications unique to fungal mitochondria may represent evolutionary innovations in regulating energy metabolism

  • Disease relevance:

    • N. crassa cox-3 research provides a model for understanding human mitochondrial diseases involving complex IV

    • The accessibility of genetic manipulation in N. crassa allows testing of pathogenic mutations found in human patients

    • Mechanisms of assembly and quality control identified in N. crassa may inform therapeutic strategies for mitochondrial disorders

  • Biotechnological applications:

    • Understanding the regulation of mitochondrial respiration in N. crassa could inform strategies for metabolic engineering

    • Insights into membrane protein assembly may guide improved expression systems for difficult-to-express membrane proteins

    • N. crassa mitochondrial features could inspire synthetic biology approaches to create artificial respiratory systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.