Recombinant Neurospora crassa Formation of crista junctions protein 1 (fcj1)

Shipped with Ice Packs
In Stock

Description

Genetic Identity and Expression

Neurospora crassa Fcj1 is encoded by the mic60 gene (also known as NCU00894 or B13C5.200) and is recognized as part of the MICOS complex (Mitochondrial Contact Site and Cristae Organizing System) . The protein is typically produced as a recombinant construct in expression systems such as Escherichia coli, where it can be fused with tags such as a His-tag to facilitate purification and analysis . This approach allows researchers to obtain the protein in sufficient quantities for structural and functional studies.

Homology with Other Species

Although Neurospora crassa Fcj1 serves similar functions to its counterparts in other organisms, sequence homology analysis reveals relatively low sequence identity. For instance, Neurospora crassa Fcj1 shares approximately 13% sequence identity with human mitofilin and 12% with mouse mitofilin . Despite this limited sequence similarity, the proteins share important structural features, particularly in the C-terminal region, suggesting evolutionary conservation of function rather than sequence . This pattern indicates that the three-dimensional structure and functional domains of the protein are more conserved than the primary amino acid sequence.

Expression Systems and Purification

Recombinant Neurospora crassa Fcj1 protein is typically expressed in E. coli expression systems, which provide an efficient platform for producing substantial quantities of the protein for research purposes . The recombinant protein is often fused to an N-terminal histidine tag (His-tag) to facilitate purification using affinity chromatography techniques. This approach enables researchers to isolate the protein with high purity (greater than 90% as determined by SDS-PAGE) .

Role in Cristae Junction Formation

Fcj1 plays a critical role in the formation and maintenance of crista junctions (CJs), which are narrow tubular connections between the inner boundary membrane and the cristae membranes in mitochondria . Studies in yeast have demonstrated that Fcj1 is specifically enriched at these junction sites . The importance of Fcj1 in CJ formation is evidenced by the observation that cells lacking this protein exhibit a complete absence of crista junctions and instead display concentric stacks of inner membrane within the mitochondrial matrix .

The C-terminal domain of Fcj1 is particularly important for the formation of these crista junctions, as indicated by research examining the functional domains of the protein . This domain likely mediates interactions with other proteins involved in maintaining mitochondrial membrane architecture.

Regulation of Mitochondrial Membrane Morphology

Interestingly, overexpression of Fcj1 has been shown to cause increased crista junction formation, branching of cristae, and enlargement of crista junction diameter . These observations suggest that Fcj1 levels must be precisely regulated to maintain normal mitochondrial membrane architecture.

Interaction with F1F0-ATP Synthase Complexes

One of the most significant aspects of Fcj1 function is its antagonistic relationship with the F1F0-ATP synthase complex, particularly its subunits e and g (Su e/g), which promote oligomerization of the ATP synthase . Research indicates that Fcj1 regulates the oligomeric state of F1F0 supercomplexes in an adverse manner, with cells lacking Fcj1 showing increased levels of these supercomplexes .

The dynamic interplay between Fcj1 and the F1F0-ATP synthase complex appears to be crucial for controlling membrane curvature in mitochondrial cristae. The current model suggests that Fcj1 and Su e/g have opposing effects on F1F0 oligomerization, thereby locally modulating membrane curvature to generate both crista junctions and cristae tips . This mechanism represents a fundamental aspect of mitochondrial membrane organization.

Impact on Nucleoid Distribution and Size

Recent research has uncovered an unexpected role for Fcj1 in maintaining the distribution and size of mitochondrial DNA (mtDNA) nucleoids . In cells lacking Fcj1, nucleoids have been observed to aggregate, increase in size, and decrease in number . This phenomenon suggests that Fcj1 contributes to the proper segregation and distribution of mtDNA within the mitochondrial network.

Microscopy studies have revealed that Fcj1 forms punctate structures that localize adjacent to nucleoids . This spatial relationship indicates a potential direct or indirect interaction between Fcj1 and the machinery involved in mtDNA maintenance and distribution.

Relationship with Mitochondrial Division

The connection between Fcj1 and mitochondrial DNA organization appears to be linked to mitochondrial division processes. Research has shown that preventing mitochondrial division by deleting the DNM1 gene (required for organelle division) enhances the aggregation of mtDNA nucleoids in cells lacking Fcj1 . This observation suggests that the combined effects of impaired crista junction formation and defective mitochondrial division have synergistic negative impacts on mtDNA organization.

Conversely, deleting F1F0-ATP synthase dimerization factors has been shown to restore tubular mitochondrial morphology and suppress nucleoid aggregation in Fcj1-deficient cells . This finding further supports the model of antagonistic functions between Fcj1 and F1F0-ATP synthase components in regulating mitochondrial membrane architecture and, consequently, nucleoid distribution.

Components of the MICOS Complex

Fcj1 does not function in isolation but rather as part of a larger protein complex known as the MICOS (Mitochondrial Contact Site and Cristae Organizing System) complex. In various organisms, Fcj1 (also known as Mic60) interacts with several other mitochondrial proteins, including Mos1/Mio10/Mcs10 (called MINOS1 in mammals), Mos2, Aim5, Aim13, and Aim37 . These interactions are essential for the proper functioning of the MICOS complex in maintaining connections between cristae and boundary membranes.

The severity of mitochondrial morphological defects varies among different MICOS component mutants, with the most pronounced effects observed in cells lacking Fcj1 and Mos1 . This observation highlights the particular importance of these two proteins within the complex.

Interaction with the TOB/SAM Complex

Beyond its interactions with MICOS components, Fcj1 has been found to interact with the TOB/SAM (Topogenesis of Outer membrane β-Barrel proteins/Sorting and Assembly Machinery) complex in mitochondria . This interaction likely represents a functional link between the organization of the inner mitochondrial membrane, where Fcj1 is primarily located, and the outer mitochondrial membrane, where the TOB/SAM complex facilitates the insertion of β-barrel proteins.

The C-terminal domain of Fcj1 appears to be particularly important for this interaction with the TOB/SAM complex . This finding suggests that Fcj1 may serve as a bridge between inner and outer membrane organizing systems, contributing to the coordinated architecture of the entire mitochondrial membrane system.

Model System for Mitochondrial Membrane Biology

Recombinant Neurospora crassa Fcj1 protein serves as a valuable tool for investigating fundamental aspects of mitochondrial membrane biology. Its role in crista junction formation makes it an excellent model for studying how membrane curvature is generated and maintained in complex organelles like mitochondria . Research on Fcj1 has contributed significantly to our understanding of the molecular mechanisms underlying mitochondrial membrane architecture.

Implications for Mitochondrial Dysfunction in Disease

While the direct clinical relevance of Neurospora crassa Fcj1 is limited, research on this protein has broader implications for understanding mitochondrial dysfunction in human diseases. The mammalian homolog of Fcj1, known as mitofilin, has been implicated in various pathological conditions associated with altered mitochondrial morphology and function . Insights gained from studying Fcj1 in model organisms like Neurospora crassa and yeast can potentially inform therapeutic strategies targeting mitochondrial membrane organization in disease contexts.

Tool for Investigating Evolutionary Conservation of Mitochondrial Processes

Despite relatively low sequence identity with its mammalian counterparts, Neurospora crassa Fcj1 shares important functional and structural features with mitofilin proteins in other species . This evolutionary conservation makes it a useful model for investigating the fundamental aspects of mitochondrial biology that have been preserved across diverse organisms. Comparative studies involving Fcj1 can help identify the core components and mechanisms essential for mitochondrial function throughout eukaryotic evolution.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have any specific requirements for the format, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
mic60; B13C5.200; NCU00894; MICOS complex subunit mic60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
49-672
Protein Length
Full Length of Mature Protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
mic60
Target Protein Sequence
VPEPSQPAVLPASETLTSPSTPPPASPQVEPTSTVPPETTPLTPPTPEATVIPPVAEEPV VPPTLPTPRKKKGFFRRLRNFFLSLTILGAIAFGGGVYYSRINDAFHDFFTEYIPYGEQA VLYLEELDFKKRFPDVVSRVTGRPRDSGEQVKVPAQSGASWRVASGGEPAGRQSSSIKKA GAAAQDAVPKSEPAVVAAAKEDTAELPKTEATTTATPAEPAPAPAATDASGTPVKKPFKA PEVDEPSRWPPASPIDPLTVNGATDPIVQDLVKMLNDVITVINHDNANEKYAPTICKAKN ELSKVADKINEMKAKVEADAAKQVKARVDGFDKAANELVSRVESAMAAQEAAWRREFEEE ITRLKKSYDEKVHLIQDREHQIAEEKLNNRLLEQAIQLQRQFTENIKKHVEQERDGRLGK LNELHKAVAELERLTSGLNEVVDTNLRTQQLHVAVDAVRASLEDAHHPRPFIKELVALKE IAADDPVVDAAIASINPTAYQRGIPTTAELIDRFRRVATEVRKASLLPEDAGVASHASSY VLSKLMFKKEGLAAGDDVESILTRTQTYLEEGDLDNAAREMNGLKGWAKTLSRDWLGEVR KVLEVQQALDVIQAEARLQSLRVE
Uniprot No.

Target Background

Function
Formation of crista junctions protein 1 (fcj1) is a component of the MICOS complex. This complex is a large protein assembly found within the mitochondrial inner membrane. It plays critical roles in maintaining crista junctions, preserving the architecture of the inner membrane, and facilitating the formation of contact sites with the outer membrane. Fcj1 contributes to the connection of cristae membranes to the inner boundary membrane and promotes protein import through the mitochondrial intermembrane space assembly (MIA) pathway.
Database Links

KEGG: ncr:NCU00894

Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Fcj1 and what is its role in mitochondria?

Fcj1 (Formation of crista junctions protein 1) is a mitochondrial membrane protein specifically enriched at crista junctions (CJs) in Neurospora crassa. It plays a critical role in determining the architecture of the mitochondrial inner membrane by regulating the formation and structure of CJs . Functionally, Fcj1 acts antagonistically to the F1FO-ATP synthase complex, locally modulating its oligomeric state to control membrane curvature, thereby generating CJs and influencing cristae morphology . This protein is also known as Mic60 and is part of the MICOS (Mitochondrial Contact Site and Cristae Organizing System) complex .

What is the domain structure of Fcj1?

The domain structure of Fcj1 includes:

  • A mitochondrial-targeting sequence (MTS)

  • A transmembrane segment (TM)

  • A coiled-coiled domain

  • A conserved C-terminal domain (CTD)

This structural organization is crucial for the protein's localization and function within the mitochondrial membrane. The transmembrane domain anchors the protein in the inner mitochondrial membrane, while other domains likely mediate interactions with partner proteins and affect membrane curvature at CJs .

How does Fcj1 influence mitochondrial morphology?

Fcj1 has a profound impact on mitochondrial morphology at both macroscopic and ultrastructural levels. Studies show that:

  • Deletion effects: Cells lacking Fcj1 exhibit altered mitochondrial morphology, completely lack CJs, and display concentric stacks of inner membrane in the mitochondrial matrix .

  • Overexpression effects: Increased expression of Fcj1 leads to enhanced CJ formation, branching of cristae, and enlargement of CJ diameter .

  • Localization pattern: Immunogold labeling reveals that Fcj1 is most prominently clustered near CJs, with lower density in the cristae membrane (CM) adjacent to CJs, and moderate presence in other parts of the inner membrane .

These morphological changes correlate with the protein's role in antagonizing F1FO supercomplex formation, thereby influencing membrane curvature at specific locations within mitochondria .

What expression systems are effective for producing recombinant Fcj1?

For recombinant production of N. crassa Fcj1, E. coli expression systems have proven effective. The mature protein (amino acids 49-672) can be expressed with an N-terminal His-tag for purification purposes . The recombinant protein specifications include:

ParameterSpecification
SpeciesNeurospora crassa
SourceE. coli
TagHis
Protein LengthFull Length of Mature Protein (49-672)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

For optimal results, the recombinant protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage at -20°C/-80°C .

What microscopy techniques are most informative for studying Fcj1 localization and function?

Multiple advanced imaging techniques have proven valuable for investigating Fcj1:

These techniques have revealed that CJs are not static structures but undergo continuous remodeling in a manner dependent on the MICOS complex, of which Fcj1 is a component .

How can researchers quantitatively assess the effects of Fcj1 manipulation?

Quantitative assessment of Fcj1 manipulation can be performed through several methodological approaches:

  • Counting CJs and cristae tips: Electron micrographs of chemically fixed cells can be analyzed to determine the numbers of CJs and cristae tips per mitochondrial section, providing a direct measure of Fcj1's impact on mitochondrial ultrastructure .

  • Measuring distances between F1FO particles: In Fcj1-deletion mitochondria, the majority of observed distances between F1FO particles falls between 14-16 nm, indicating ordered oligomeric arrangements. This pattern is disrupted by additional deletion of Su g, resulting in a random distribution with broader distance ranges .

  • Assessing protein levels: Western blotting with fractionation (separating mitochondria, microsomes, and cytosol) can confirm the mitochondrial localization of Fcj1 and determine its expression levels in various experimental conditions .

  • Membrane potential measurements: Since cristae architecture affects mitochondrial function, membrane potential measurements can provide functional readouts of Fcj1 manipulation .

How does Fcj1 interact with the F1FO-ATP synthase complex to regulate cristae morphology?

The relationship between Fcj1 and the F1FO-ATP synthase complex represents a fascinating antagonism that regulates cristae morphology. Multiple lines of evidence illuminate this interaction:

  • Oligomeric state modulation: Fcj1 regulates the oligomeric state of the F1FO supercomplex in an adverse manner. Cells lacking Fcj1 show increased levels of F1FO supercomplexes, while overexpression of Fcj1 reduces these levels .

  • Genetic interaction: Fcj1 genetically interacts with subunits e and g (Su e/g) of F1FO, which normally promote oligomerization of F1FO .

  • Zipperlike structures: In Fcj1-deletion mitochondria, electron microscopy reveals zipperlike structures representing oligomers of F1FO. These structures can be disrupted by additional deletion of Su e or Su g, confirming their identity as F1FO oligomers .

  • Opposing membrane curvature effects: The F1FO complex promotes positive membrane curvature at cristae tips, while Fcj1 appears to promote negative curvature at CJs. This antagonism creates the characteristic architecture of cristae with narrow tubular CJs connecting to the larger cristae lamellae .

These findings support a model where the local balance between Fcj1 and F1FO oligomers determines membrane curvature at specific locations, generating both CJs and cristae tips .

What are the dynamics of crista junctions, and how does Fcj1 contribute to these processes?

Recent research has revealed that crista junctions are not static structures but undergo continuous remodeling:

  • Continuous cycles: Cristae membranes undergo continuous cycles of remodeling, representing membrane fission and fusion events within individual mitochondria .

  • MICOS-dependent mechanism: These dynamic events occur in a MICOS-dependent manner, with Fcj1/Mic60 being a key component of this complex .

  • Membrane potential relationship: The dynamics of cristae membranes appear to be linked to mitochondrial membrane potential, suggesting functional implications for these structural changes .

  • Temporal aspects: Advanced imaging techniques including live-cell STED nanoscopy have enabled the visualization of these dynamic processes in real-time, providing insights into the temporal aspects of CJ remodeling .

The contribution of Fcj1 to these dynamics likely involves its role in antagonizing F1FO oligomerization, thereby allowing the necessary flexibility in membrane curvature required for dynamic remodeling events .

What is the molecular basis for Fcj1 localization specifically at crista junctions?

The specific enrichment of Fcj1 at CJs raises questions about the molecular mechanisms governing this precise localization:

  • Domain-specific targeting: The protein contains a mitochondrial-targeting sequence for general mitochondrial import, but the specific CJ localization likely involves additional targeting mechanisms related to its transmembrane segment and/or other domains .

  • Protein-protein interactions: Immunogold electron microscopy shows Fcj1 clustered in close proximity to CJs, suggesting potential interactions with other proteins or lipids specifically present at these sites .

  • Membrane curvature sensing: The necklike region near CJs exhibits high positive membrane curvature, while CJs themselves have negative curvature. The relative absence of Fcj1 in the neck region and its enrichment at CJs suggest it may preferentially associate with negatively curved membranes .

  • Oligomeric state: The clustering of Fcj1 at CJs suggests it may form oligomeric structures that stabilize the unique membrane architecture at these sites .

Understanding these localization mechanisms remains an active area of research and may provide insights into how mitochondrial subdomains are established and maintained.

What are effective strategies for overexpression and down-regulation of Fcj1 in experimental systems?

For precise manipulation of Fcj1 levels in experimental systems, several strategies have proven effective:

  • Doxycycline-repressible promoter system: This approach allows for controlled overexpression of Fcj1, enabling a five- to ten-fold increase in protein levels. Such systems have successfully demonstrated that Fcj1 overexpression correlates with a two- to three-fold increase in CJ numbers per cell .

  • Gene deletion approaches: Complete knockout of the Fcj1 gene provides valuable insights into its necessity for CJ formation. Deletion strains show distinctive phenotypes including the absence of CJs and the formation of concentric stacks of inner membrane in the mitochondrial matrix .

  • Combinations with other deletions: Double deletion approaches (such as Δfcj1/Δsu g) have been instrumental in elucidating genetic interactions between Fcj1 and components of the F1FO complex .

  • Expression vector selection: For recombinant expression, E. coli systems with appropriate tags (such as His-tag) facilitate purification and subsequent functional studies .

Each approach offers distinct advantages depending on the research question, with overexpression systems particularly useful for studying gain-of-function effects on CJ formation and architecture.

What storage and handling protocols maximize the stability and activity of recombinant Fcj1?

Proper storage and handling of recombinant Fcj1 are critical for maintaining its stability and functional activity:

  • Initial processing: After expression and purification, the lyophilized protein should be briefly centrifuged prior to opening to bring contents to the bottom of the vial .

  • Reconstitution: The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Storage conditions:

    • Add 5-50% glycerol (final concentration) for long-term storage

    • Aliquot to minimize freeze-thaw cycles

    • Store at -20°C/-80°C

    • Working aliquots can be stored at 4°C for up to one week

  • Freeze-thaw considerations: Repeated freezing and thawing is not recommended as it can lead to protein denaturation and loss of activity .

  • Buffer composition: The protein is most stable in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

Adhering to these storage and handling protocols ensures that functional studies with recombinant Fcj1 yield reliable and reproducible results.

How can researchers effectively distinguish between direct Fcj1 effects and secondary consequences of altering mitochondrial architecture?

Distinguishing direct Fcj1 effects from secondary consequences of altered mitochondrial architecture presents a significant challenge in research. Several methodological approaches can help address this issue:

  • Time-course experiments: Analyzing the temporal sequence of events following Fcj1 manipulation can help identify primary versus secondary effects. Direct effects typically occur more rapidly than downstream consequences.

  • Structure-function studies: Creating Fcj1 variants with specific domain mutations or deletions can help map which protein regions are responsible for particular phenotypes.

  • In vitro reconstitution: Purified components in simplified membrane systems can reveal direct biochemical activities of Fcj1 in the absence of the complex mitochondrial environment.

  • Combining genetic approaches: Epistasis analysis through double deletion or overexpression studies (e.g., Fcj1 with F1FO subunits) can reveal functional relationships and delineate primary effects .

  • High-resolution temporal imaging: Techniques like live-cell STED nanoscopy can capture the immediate consequences of Fcj1 manipulation before secondary architectural changes fully manifest .

By employing these complementary approaches, researchers can build a more complete understanding of Fcj1's direct molecular functions versus the downstream consequences of altered cristae architecture.

What are the remaining gaps in our understanding of Fcj1 function?

Despite significant progress, several important knowledge gaps remain in our understanding of Fcj1:

  • Precise molecular mechanism: While Fcj1 clearly influences membrane curvature and CJ formation, the exact molecular mechanism by which it antagonizes F1FO oligomerization remains unclear.

  • Interaction partners: The full complement of Fcj1 interaction partners beyond F1FO components has not been fully characterized, particularly potential interactions with lipids that might influence membrane curvature.

  • Regulatory mechanisms: How Fcj1 activity and localization are regulated in response to different metabolic states or stress conditions remains largely unexplored.

  • Evolutionary conservation: While functional homologs exist across species (like Mic60 in mammals), the degree of functional conservation and species-specific adaptations requires further investigation.

  • Contribution to disease: The potential role of Fcj1/Mic60 dysfunction in mitochondrial diseases and other pathological conditions represents an important area for translational research.

Addressing these knowledge gaps will require innovative approaches combining structural biology, systems biology, and advanced imaging techniques.

What emerging technologies might advance our understanding of Fcj1 and crista junction dynamics?

Several emerging technologies hold promise for deepening our understanding of Fcj1 and crista junction dynamics:

  • Cryo-electron tomography: This technique can provide near-atomic resolution of CJ structure in its native state, potentially revealing how Fcj1 organizes at these sites.

  • Super-resolution live-cell imaging: Advances in techniques like STED, PALM, and STORM, especially when applied to living cells, can reveal dynamic aspects of Fcj1 behavior and CJ remodeling with unprecedented spatial and temporal resolution .

  • Proximity labeling proteomics: Techniques like BioID or APEX2 fused to Fcj1 could identify transient or weak interaction partners specifically at CJs.

  • In situ structural techniques: Methods like in-cell NMR or electron paramagnetic resonance (EPR) could provide structural information about Fcj1 in its native environment.

  • Organelle-specific optogenetics: Light-activated control of Fcj1 activity or localization could enable precise temporal studies of cause-effect relationships in CJ formation and dynamics.

These technologies, especially when used in combination, promise to overcome current technical limitations in studying the dynamic and complex architecture of mitochondrial membranes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.