Recombinant Neurospora crassa Golgi apparatus membrane protein tvp-23 (tvp-23)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Neurospora crassa Golgi apparatus membrane protein TVP-23 (TVP-23) is a genetically engineered protein expressed for research purposes. Derived from the filamentous fungus Neurospora crassa, TVP-23 is a transmembrane protein associated with Golgi-mediated vesicular transport and intracellular membrane dynamics. This protein is part of the conserved FAM18/TVP23 superfamily, which plays roles in retrograde transport, glycosylation, and maintaining Golgi structural integrity .

Functional Insights

  • Vesicular Transport: TVP-23 homologs in yeast (Saccharomyces cerevisiae) interact with SNARE proteins like Vti1p, regulating retrograde transport from early endosomes to the late Golgi . Deletion of TVP23 in yeast exacerbates defects in SNARE-mediated vesicle recycling .

  • Golgi Homeostasis: Mammalian TVP23B maintains intestinal barrier function by regulating glycosylation enzymes critical for mucin layer formation . This suggests TVP-23’s potential role in secretory pathway quality control.

  • Conservation: TVP-23 is highly conserved across eukaryotes, with paralogs (TVP23A, TVP23B, TVP23C) in humans involved in neurodegenerative and inflammatory diseases .

Expression and Purification

  • Recombinant TVP-23 is produced in E. coli with >90% purity (SDS-PAGE verified) .

  • The protein is supplied in lyophilized form, requiring reconstitution in sterile water or glycerol-containing buffers .

Applications in Research

  • Protein Interaction Studies: Used to investigate SNARE-mediated vesicle trafficking mechanisms .

  • Antibody Validation: Serves as a control fragment in immunoblotting and immunohistochemistry (e.g., PA5-63881 antibody validation) .

  • Comparative Genomics: Facilitates studies on Golgi function across fungi, plants, and mammals due to structural conservation .

Limitations and Future Directions

  • Functional Gaps: Direct evidence of TVP-23’s role in Neurospora crassa remains limited. Most functional data derive from yeast and mammalian homologs .

  • Structural Studies: No resolved 3D structure exists for TVP-23; cryo-EM or crystallography could clarify its mechanistic role.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
tvp23; NCU02733; Golgi apparatus membrane protein tvp23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
tvp23
Target Protein Sequence
MEATPTPGSLSWRLSSHPITLLTFLAFRSSSLLVYLFGLLFTDNLVMIFIITILLLAGDF YYLKNIAGRRLVGLRWWNEVDPNSGDSHWVFESSEPGTKIINATDSRFFWLAIYAQPLLW VVLAIVALFSLKFIWLPLVAIALVLTITNSLAFSRCDKFSQASNIAGTAFSSGNIAGNIA SNMVGRFFSR
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking.
Database Links

KEGG: ncr:NCU02733

Protein Families
TVP23 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the functional role of TVP-23 in Neurospora crassa?

TVP-23 functions as a Golgi apparatus membrane protein in Neurospora crassa, likely involved in vesicular trafficking between cellular compartments. While specific functions remain under investigation, research on other fungal membrane proteins suggests roles in protein sorting, glycosylation, and secretory pathway regulation. Similar to the vesicle-associated proteins described in Neurospora, TVP-23 may participate in developmental processes including hyphal growth and conidiation . Analysis methods to determine function include:

  • Subcellular fractionation and immunolocalization

  • Co-immunoprecipitation with known Golgi apparatus markers

  • Complementation studies with deletion mutants

  • Comparative analysis with homologs in related fungal species

How does TVP-23 expression vary during different developmental stages?

TVP-23 expression likely follows developmental patterns similar to other Neurospora proteins involved in vesicular transport. Analysis of protein expression during different developmental stages can be performed using techniques demonstrated for other Neurospora proteins, where researchers separate mature conidia from aerial hyphae to characterize protein content from each developmental structure . Methodological approaches include:

  • RNA-seq analysis comparing expression levels across developmental stages

  • Western blotting of FLAG-tagged TVP-23 from different growth phases

  • Quantitative PCR to measure transcript abundance during vegetative growth versus conidiation

  • Protein localization studies using fluorescent tagging in live cells

Research has shown that some Neurospora proteins like VE-1 are predominantly expressed in submerged vegetative hyphae and less during conidiation, while others maintain consistent expression across developmental stages . Analysis of TVP-23 should include both dark and light growth conditions, as light regulation affects numerous Neurospora proteins.

What methods are most effective for detecting native TVP-23 in Neurospora samples?

For effective detection of native TVP-23, researchers should consider these methodological approaches:

  • Epitope tagging strategy: Generate strains with FLAG-tagged TVP-23 under control of the native promoter, similar to approaches used for VE-1 and VE-2 proteins .

  • Immunoblotting protocol: Optimize protein extraction from membrane fractions using detergents suitable for membrane proteins while validating that tagged constructs maintain wild-type functionality.

  • Sample preparation: Separate developmental structures (conidial vs. hyphal samples) to examine differential expression.

  • Control experiments: Compare growth of strains with tagged TVP-23 against wild-type to ensure tagging doesn't disrupt function .

How can researchers create and validate a TVP-23 deletion mutant in Neurospora crassa?

Creating and validating a TVP-23 deletion mutant requires systematic approaches:

  • Gene targeting strategy:

    • Construct deletion cassette with selection marker flanked by homologous sequences

    • Transform Neurospora using established protocols for homologous recombination

    • Screen transformants using PCR to confirm correct integration

  • Phenotypic analysis protocol:

    • Assess growth rates on different media

    • Examine aerial hyphae development and conidiation in both light and dark conditions

    • Quantify conidial production using hemocytometer counting

    • Compare results to wild-type controls under identical conditions

  • Validation experiments:

    • Perform Southern blot analysis to confirm single integration

    • Conduct complementation with wild-type gene

    • Examine transcript absence using reverse transcription PCR

  • Data analysis parameters:

    • Measure aerial hyphae length in glass tubes with solid agar medium

    • Quantify conidiation under both dark and light conditions

    • Analyze statistical significance using appropriate tests

What expression systems are optimal for producing recombinant TVP-23 for structural studies?

For structural characterization of TVP-23, researchers should consider these expression systems and methodological details:

Expression SystemAdvantagesChallengesPurification Strategy
E. coliHigh yield, cost-effectiveMay lack proper folding for membrane proteinsDetergent screening crucial; IMAC followed by size exclusion
P. pastorisBetter folding of eukaryotic proteinsLonger expression timeMembrane fraction isolation; affinity chromatography
Homologous expression in N. crassaNative-like folding and modificationsLower yieldFLAG-tag purification under native conditions
Insect cell systemExcellent for membrane proteinsHigher costDetergent solubilization optimization required

Methodological considerations include:

  • Screening multiple detergents for optimal solubilization while maintaining structure

  • Using circular dichroism spectroscopy to verify secondary structure post-purification

  • Implementing fluorescence-detection size exclusion chromatography to assess protein stability

  • Validating protein functionality through complementation assays in deletion mutants

How should researchers design RNA-seq experiments to study TVP-23 transcriptional regulation?

RNA-seq experimental design for TVP-23 regulation studies should consider the following methodological aspects:

  • Sample preparation protocol:

    • Harvest samples from multiple developmental stages (vegetative hyphae, aerial hyphae, developing conidia)

    • Include light and dark growth conditions to capture light-responsive regulation

    • Compare wild-type and relevant mutant strains (e.g., transcription factor mutants)

    • Maintain biological replicates (minimum 3) for statistical validity

  • Technical considerations:

    • RNA extraction optimization for consistent yield across developmental stages

    • Library preparation with rRNA depletion rather than poly(A) selection

    • Sequencing depth of ≥20 million reads per sample for differential expression analysis

    • Include spike-in controls for normalization

  • Data analysis pipeline:

    • Identify differentially expressed genes between conditions

    • Perform gene ontology enrichment analysis for functional clustering

    • Compare conidiation transcriptomes between wild-type and mutant strains

    • Use proper statistical methods to identify significantly altered genes

How does TVP-23 interact with the velvet complex proteins in Neurospora?

The velvet complex in Neurospora crassa consists of VE-1, VE-2, and LAE-1 proteins that regulate gene expression in response to environmental signals and developmental processes . Investigating TVP-23 interactions with these proteins requires sophisticated approaches:

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation using FLAG-tagged TVP-23

    • Proximity labeling techniques (BioID or APEX) for transient interactions

    • Yeast two-hybrid screening with membrane adaptations

    • Split-GFP complementation assays in vivo

  • Transcriptional analysis in deletion backgrounds:

    • Generate double mutants of TVP-23 with velvet complex components

    • Perform RNA-seq to identify genes co-regulated by TVP-23 and velvet proteins

    • Compare transcriptomes using hierarchical clustering and principal component analysis

  • Localization studies:

    • Conduct co-localization experiments using differentially tagged proteins

    • Implement super-resolution microscopy to resolve Golgi compartments

    • Examine protein localization in response to environmental signals such as light

What methodologies are most effective for studying post-translational modifications of TVP-23?

To characterize post-translational modifications (PTMs) of TVP-23, researchers should employ these methodological approaches:

  • Mass spectrometry protocols:

    • Enrichment strategies for phosphorylated, glycosylated, or ubiquitinated peptides

    • Multiple fragmentation methods (HCD, ETD) for comprehensive PTM mapping

    • Quantitative approaches (SILAC, TMT) to compare modification states across conditions

    • Site-directed mutagenesis of identified PTM sites to confirm functional relevance

  • Glycosylation analysis:

    • Enzymatic deglycosylation combined with mobility shift assays

    • Lectin affinity chromatography for glycoform enrichment

    • Glycosidase treatment followed by mass spectrometry

    • Metabolic labeling with azido sugars for glycoprotein visualization

  • Experimental designs for functional assessment:

    • Generate point mutations at PTM sites and assess phenotypes

    • Compare PTM patterns between developmental stages

    • Analyze PTM changes in response to environmental stressors

    • Develop antibodies specific to modified forms of TVP-23

How can researchers investigate the role of TVP-23 in protein trafficking during conidiation?

Investigating TVP-23's role in protein trafficking during conidiation requires integrative approaches:

  • Vesicle trafficking analysis techniques:

    • Live-cell imaging using fluorescently-tagged cargo proteins

    • Pulse-chase experiments with secreted marker proteins

    • Electron microscopy to visualize Golgi morphology in TVP-23 mutants

    • Brefeldin A sensitivity assays to assess Golgi dependency

  • Conidiation-specific experimental designs:

    • Synchronize conidiation using temperature shifts or light induction

    • Stage-specific protein extraction from aerial hyphae and developing conidia

    • Quantify protein secretion during different stages of conidial development

    • Comparison between wild-type and TVP-23 deletion strains

  • Genetic interaction analysis:

    • Generate double mutants with known conidiation regulators

    • Assess conidiophore development and conidial production quantitatively

    • Perform suppressor screens to identify functional partners

    • Create conditional alleles for temporal studies

How should researchers analyze contradictory TVP-23 localization data from different experimental approaches?

When facing contradictory localization data for TVP-23, researchers should implement these analytical strategies:

  • Technical validation approaches:

    • Compare multiple tagging strategies (N-terminal vs. C-terminal tags)

    • Validate functionality of tagged constructs through complementation assays

    • Use orthogonal methods (e.g., immunofluorescence vs. biochemical fractionation)

    • Implement controls for fixation artifacts using multiple fixation protocols

  • Resolution of conflicting data:

    • Determine if discrepancies relate to specific developmental stages or growth conditions

    • Consider dynamic localization patterns that may change during the cell cycle

    • Evaluate tag interference with trafficking signals or transmembrane domains

    • Implement super-resolution microscopy to resolve subcompartments

  • Statistical analysis framework:

    • Quantify co-localization with established markers using correlation coefficients

    • Apply stringent thresholds for determining significant co-localization

    • Use appropriate statistical tests to compare different experimental conditions

    • Implement blinded analysis to prevent confirmation bias

What computational approaches are recommended for comparative analysis of TVP-23 across fungal species?

For comparative analysis of TVP-23 across fungal species, researchers should implement these computational methods:

  • Sequence analysis pipeline:

    • Multiple sequence alignment using algorithms optimized for membrane proteins

    • Phylogenetic tree construction using maximum likelihood methods

    • Transmembrane domain prediction and conservation analysis

    • Identification of conserved motifs and functional domains

  • Structural prediction approaches:

    • Homology modeling using related structures as templates

    • Ab initio modeling for unique domains

    • Molecular dynamics simulations to assess structural stability

    • Conservation mapping onto predicted structures to identify functional surfaces

  • Evolutionary analysis methods:

    • Calculate selection pressures (dN/dS ratios) across protein regions

    • Identify lineage-specific accelerated evolution

    • Compare evolutionary rates between Golgi proteins

    • Correlate evolutionary patterns with known functional domains

  • Visualization and interpretation techniques:

    • Generate heat maps of sequence conservation across fungal clades

    • Create interactive visualizations of evolutionary relationships

    • Implement statistical tests for convergent evolution

    • Correlate sequence divergence with ecological niches

What are the most promising future research directions for TVP-23 functional characterization?

Future research on TVP-23 should focus on these methodological approaches:

  • High-throughput interaction studies:

    • Proximity-dependent biotinylation to identify the TVP-23 interactome

    • CRISPR-based screens to identify genetic interactions

    • Systematic mutation analysis to map functional domains

    • Comparative interactomics across developmental stages

  • Integrative multi-omics approaches:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Correlate TVP-23 expression with secretome changes

    • Map TVP-23 into existing gene regulatory networks

    • Apply systems biology modeling to predict functional impacts

  • Advanced imaging approaches:

    • Implement live-cell super-resolution microscopy

    • Track single molecules to determine TVP-23 dynamics

    • Correlative light and electron microscopy for ultrastructural context

    • Optogenetic tools to manipulate TVP-23 function with temporal precision

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.