Recombinant Neurospora crassa High osmolarity signaling protein sho1 (sho1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sho1; NCU08067; High osmolarity signaling protein sho1; Osmosensor sho1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
sho1
Target Protein Sequence
MEHGRNSYRRKGIDMGNIIGDPFALATTSIATLSWIIILFGSIFGFRDQNDGSNGAPVIV WPTYSWFTLVFNFFLILGIFIVIASDSAQTYHVAIVGYLAVGLVGSTSSINNLIYSGVAS MEATAAGYILLSMVTIIWIFYFGSAPSAVPRAYIDSFALTKESTLPAHHMSRQTMNHNGL SSPNAYGSYNMRPETSASGLQPPQMYTGQLNGLENPARQSQIPQGFSSNNIPKPQGEGEI VPPTEYPYRAKAIFSYEANPDDANEISFSKHEVLEISDVSGRWWQARKENGETGIAPSNY LILL
Uniprot No.

Target Background

Function
A plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to hyperosmolarity.
Database Links

KEGG: ncr:NCU08067

Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Neurospora crassa and why is it an important model organism?

Neurospora crassa is a filamentous fungus widely used as a model organism in genetic, cellular, and molecular research. It has significantly contributed to our understanding of fundamental biological processes including gene regulation, circadian rhythms, and cell wall development. N. crassa has a fully sequenced genome and well-established genetic manipulation techniques, making it an excellent system for studying eukaryotic cellular processes. Research conferences, such as Neurospora 2018 held at Asilomar Conference Center, regularly bring together scientists to share advances in this field .

What is the function of Sho1 protein in Neurospora crassa?

The High Osmolarity Signaling Protein Sho1 in N. crassa functions as an osmosensor involved in stress response pathways. The full-length protein consists of 304 amino acids and contains membrane-spanning domains that enable it to detect changes in osmotic conditions. Sho1 plays a crucial role in signaling mechanisms that help the fungus adapt to environmental stresses, particularly high osmolarity conditions . This protein is part of broader signaling networks that regulate cellular responses to environmental changes in N. crassa.

How does Sho1 relate to other signaling pathway components?

Sho1 functions within interconnected signaling networks in N. crassa. While the search results don't provide explicit details about Sho1's direct interactions, we can infer from research on related proteins like GUL-1 that these signaling components often participate in multiple cellular processes. GUL-1, for instance, interacts with over 100 different proteins, including components of MAPK pathways and the COT-1 and STRIPAK complexes . Sho1 likely participates in similar signaling networks, potentially connecting osmotic stress sensing to broader cellular adaptation mechanisms.

What are the key specifications of recombinant Neurospora crassa Sho1 protein?

The recombinant full-length Neurospora crassa High Osmolarity Signaling Protein Sho1 (amino acids 1-304) is produced with an N-terminal His-tag through expression in E. coli. The protein has the following amino acid sequence:

MEHGRNSYRRKGIDMGNIIGDPFALATTSIATLSWIIILFGSIFGFRDQNDGSNGAPVIVWPTYSWFTLVFNFFLILGIFIVIASDSAQTYHVAIVGYLAVGLVGSTSSINNLIYSGVASMEATAAGYILLSMVTIIWIFYFGSAPSAVPRAYIDSFALTKESTLPAHHMSRQTMNHNGLSSPNAYGSYNMRPETSASGLQPPQMYTGQLNGLENPARQSQIPQGFSSNNIPKPQGEGEIVPPTEYPYRAKAIFSYEANPDDANEISFSKHEVLEISDVSGRWWQARKENGETGIAPSNYLILL

The purified protein typically achieves greater than 90% purity as determined by SDS-PAGE and is provided as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0 .

What are the recommended storage and handling protocols for recombinant Sho1?

For optimal stability and activity, the recombinant Sho1 protein should be:

  • Briefly centrifuged prior to opening to bring contents to the bottom of the vial

  • Reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Supplemented with glycerol (5-50% final concentration, with 50% being standard) for long-term storage

  • Aliquoted to avoid repeated freeze-thaw cycles

  • Stored at -20°C/-80°C for long-term storage

  • Working aliquots may be stored at 4°C for up to one week

Repeated freezing and thawing should be avoided as it may lead to protein degradation and loss of activity.

How should recombinant Sho1 be reconstituted for experimental use?

For proper reconstitution of lyophilized Sho1 protein:

  • Centrifuge the vial briefly to collect the powder at the bottom

  • Add deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL

  • Gently mix until completely dissolved

  • For long-term storage, add glycerol to a final concentration of 5-50% (50% is recommended)

  • Aliquot into smaller volumes to prevent repeated freeze-thaw cycles

This reconstitution method ensures optimal protein stability and activity for downstream applications.

What experimental systems are suitable for studying Sho1 function?

Multiple experimental approaches can be employed to study Sho1 function:

  • Genetic manipulation in N. crassa: Deletion or modification of the sho1 gene can reveal its function in vivo, similar to approaches used for other genes like spo11 and heat shock factor 1

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation or yeast two-hybrid assays can identify Sho1 binding partners, as has been done with other signaling proteins like GUL-1, which interacts with over 100 different proteins

  • Cellular localization experiments: Fluorescent protein tagging can reveal Sho1's subcellular distribution under different conditions, similar to observations made with GUL-1 which shows stress-dependent localization to the endoplasmic reticulum

  • Biochemical assays: In vitro studies using the recombinant protein to assess binding to potential interactors or substrates

How can researchers assess Sho1's role in osmotic stress response?

To evaluate Sho1's function in osmotic stress response, researchers can employ these methods:

  • Growth assays under osmotic stress: Compare wild-type and sho1 mutant strains under different osmotic conditions

  • Phosphorylation studies: Assess activation of downstream kinases (like MAPK pathway components) in response to osmotic stress in the presence or absence of functional Sho1, similar to how GUL-1's effect on MAK-1 phosphorylation has been studied

  • Transcriptomic analysis: Compare gene expression profiles between wild-type and sho1 mutant strains under osmotic stress conditions to identify Sho1-dependent gene expression changes

  • Protein localization during stress: Monitor changes in Sho1 localization during osmotic stress using fluorescently tagged protein

How does Sho1 integrate with the Cell Wall Integrity (CWI) pathway?

While the search results don't provide direct information about Sho1's relationship with the CWI pathway, research on related signaling proteins provides insights into potential mechanisms:

  • The GUL-1 protein in N. crassa affects the CWI pathway through altered phosphorylation of MAK-1 (a MAPK protein) and influences expression of the transcription factor adv-1

  • Sho1, as an osmosensor, likely plays a role in detecting cell wall stress that affects osmotic balance

  • Researchers could investigate whether Sho1 similarly affects MAK-1 phosphorylation or interacts with components of the MAPK cascade

  • Expression analysis could reveal whether Sho1 influences the expression of cell wall-related genes under stress conditions

Given that cell wall remodeling is essential for fungal adaptation to environmental stresses, further research into Sho1's role in this process would be valuable.

What is known about Sho1's potential RNA-binding capabilities?

Researchers interested in Sho1's potential RNA interactions could:

  • Perform RNA immunoprecipitation (RIP) assays with tagged Sho1 protein

  • Conduct RNA antisense purification (RAP) experiments to identify potential RNA binding partners

  • Investigate structural domains in Sho1 that might confer RNA-binding capabilities

  • Examine whether Sho1's function is affected by RNase treatment

This represents an intriguing direction for future research, given the emerging understanding of the dual protein-protein and protein-RNA interactions of signaling components.

How does Sho1 compare functionally across different fungal species?

Sho1 homologs exist across diverse fungal species, suggesting evolutionary conservation of its function. To understand cross-species functional conservation and divergence:

  • Conduct phylogenetic analysis of Sho1 protein sequences across fungal species

  • Perform complementation studies to determine if Sho1 from other species can rescue N. crassa sho1 mutant phenotypes

  • Compare protein interaction networks of Sho1 homologs across species

  • Examine species-specific adaptations in Sho1 structure and function related to different ecological niches

This comparative approach could reveal fundamental aspects of osmosensing and stress response across fungi while highlighting species-specific adaptations.

What are common challenges when working with recombinant Sho1 protein?

Researchers may encounter several challenges when working with recombinant Sho1:

  • Protein solubility issues: As a membrane-associated protein with transmembrane domains, Sho1 may have solubility challenges. Using appropriate detergents or buffer conditions is crucial.

  • Maintaining native conformation: Ensuring the recombinant protein maintains its native fold and function requires careful optimization of expression and purification conditions.

  • Protein aggregation: Prevent aggregation by following recommended storage conditions and avoiding repeated freeze-thaw cycles .

  • Functional validation: Confirming that the recombinant protein retains functional activity similar to the native protein is essential for meaningful results.

What controls should be included in experiments with recombinant Sho1?

For rigorous experimental design, include the following controls:

  • Negative controls: Use an unrelated protein with similar characteristics (size, tag) expressed and purified under identical conditions

  • Functional controls: If testing interaction with known binding partners, include positive controls with well-characterized interactions

  • Expression tag controls: Test whether the His-tag affects function by comparing with differently tagged versions or tag-cleaved protein

  • Validation across methods: Confirm key findings using multiple independent techniques

  • Biological replicates: Ensure reproducibility by performing experiments with independent protein preparations

How can expression and purification of recombinant Sho1 be optimized?

For improved expression and purification outcomes:

  • Expression optimization:

    • Test multiple E. coli strains specialized for membrane or difficult-to-express proteins

    • Optimize induction conditions (temperature, inducer concentration, duration)

    • Consider codon optimization for the E. coli expression system

  • Purification refinement:

    • Use optimized lysis buffers containing appropriate detergents for membrane-associated proteins

    • Implement multi-step purification strategies combining affinity chromatography with size exclusion or ion exchange

    • Validate protein quality by multiple methods (SDS-PAGE, Western blot, mass spectrometry)

  • Functional preservation:

    • Test additives that may stabilize protein structure during purification

    • Minimize time between purification steps

    • Consider on-column refolding if inclusion bodies form

What emerging technologies could advance Sho1 research?

Several cutting-edge approaches could significantly advance our understanding of Sho1 function:

  • Cryo-electron microscopy: Determine the high-resolution structure of Sho1, particularly in complex with interaction partners

  • Proximity labeling techniques: Identify the complete Sho1 interactome in living cells under various stress conditions

  • Single-molecule techniques: Examine the dynamics of Sho1's interactions with other proteins and potential RNA targets in real-time

  • CRISPR-based approaches: Create precise modifications in the sho1 gene to study structure-function relationships in vivo

  • Systems biology integration: Place Sho1 function within comprehensive models of fungal stress response networks

How might Sho1 research impact broader understanding of fungal biology?

Research on Sho1 has implications beyond understanding a single protein:

  • The osmotic stress response pathway represents a fundamental adaptation mechanism in fungi

  • Comparative studies of signaling pathways across fungal species can reveal evolutionary adaptations to different ecological niches

  • Understanding fungal stress responses has applications in biotechnology, agriculture, and medicine

  • Insights from Sho1 signaling may inform research on related proteins in pathogenic fungi, potentially leading to novel antifungal strategies

The ongoing research into N. crassa signaling pathways, including those involving Sho1, continues to provide valuable insights into fundamental aspects of eukaryotic cell biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.