Recombinant Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-17 (tim-17)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Tim-17

Tim-17 belongs to the evolutionarily conserved Tim17/Tim22/Tim23 protein family, which is present across the eukaryotic domain. This protein serves as an essential membrane-embedded subunit of the presequence translocase in the mitochondrial inner membrane . The Tim-17 protein from Neurospora crassa specifically contains four characteristic transmembrane domains and functions as a core component of the TIM complex .

The full-length Neurospora crassa Tim-17 consists of 155 amino acids and has a molecular mass of approximately 16.2 kDa, similar to its homologs in other species . The protein's primary sequence follows a specific pattern with highly conserved features that are critical for its functionality across different organisms . Despite variations across species, the fundamental architecture and functional domains of Tim-17 remain remarkably preserved, highlighting its evolutionary significance .

General Function in Mitochondria

Tim-17 serves as a crucial component of the mitochondrial protein import machinery, specifically within the presequence translocase of the inner membrane (TIM23 complex). This complex represents the major route for importing nuclear-encoded proteins into mitochondria . The protein works in concert with other subunits to facilitate the translocation of presequence-containing proteins across or into the inner mitochondrial membrane .

Primary Sequence and Domains

The full amino acid sequence of Neurospora crassa Tim-17 is: MDHTRDPCPWVILNDFGGAFAMGAIGGTIWHGIKGFRNSPYGERRIGAITAIKMRAPALGGNFGVWGGLFSTFDCAIKGLRNHKEDPWNSILAGFFTGGALAVRGGYKAARNGAIGCAVLLAVIEGVGIGFQKMLAGATKLEAPAPPPSNEKVLA . This 155-amino acid sequence contains multiple functionally important regions that contribute to the protein's role in the TIM complex.

Transmembrane Segments

Tim-17 contains four predicted transmembrane (TM) segments that anchor the protein within the mitochondrial inner membrane. These transmembrane domains are not merely structural elements but play distinct functional roles . Research has demonstrated that the first two transmembrane segments (TM1 and TM2) are primarily involved in interactions with Tim23, which forms part of the translocation channel . In contrast, the third transmembrane segment (TM3) appears to be crucial for binding the import motor components .

Conserved Motifs

A notable structural feature of Tim-17 is the presence of several GxxxG motifs throughout its four predicted transmembrane domains . These motifs, and their more general variant with a consensus sequence (small)xxx(small), are functionally significant as they often mediate interactions between transmembrane helices of membrane proteins . Sequence alignment of Tim-17 proteins from various species shows that residues within these motifs are highly conserved evolutionarily .

Helical wheel projections of individual transmembrane segments reveal that glycine, alanine, and serine residues of these motifs cluster on the same sides of the putative helices, suggesting their importance in protein-protein interactions within the TIM complex .

Production of Recombinant Neurospora crassa Tim-17

The production of recombinant Neurospora crassa Tim-17 involves specific expression systems and purification methods to obtain functional protein for research and commercial purposes.

Expression Systems

Recombinant Neurospora crassa Tim-17 is typically expressed in Escherichia coli expression systems, which allow for high-yield production of the protein . The recombinant protein is commonly produced with an N-terminal histidine (His) tag to facilitate purification and detection .

Reconstitution Protocols

For optimal use in experimental settings, lyophilized recombinant Tim-17 should be reconstituted following specific protocols. The recommended procedure involves centrifuging the vial briefly before opening to bring contents to the bottom, then reconstituting the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, adding glycerol to a final concentration of 5-50% and aliquoting the solution before storing at -20°C/-80°C is typically recommended .

Functional Mechanisms of Tim-17

Tim-17 plays critical roles in mitochondrial protein import through specific functional mechanisms that involve interactions with other components of the mitochondrial import machinery.

Role in Protein Translocation

Tim-17 functions as an essential component of the presequence translocase, which is responsible for importing proteins with N-terminal targeting signals (presequences) into mitochondria . These presequences form positively charged amphiphilic α-helices that direct proteins to mitochondria . Recent research indicates that Tim-17 contains conserved negative charges close to the intermembrane space side of the mitochondrial inner membrane, which are essential for initiating presequence protein translocation .

Channel Formation and Regulation

Together with Tim23, Tim-17 forms the core of the TIM23 complex onto which all other subunits assemble . While Tim23 has been shown to form at least part of the translocation channel, Tim-17 appears to play a more complex role in the assembly and regulation of the complex . The protein may bridge the translocation channel and the import motor of the TIM23 complex, guiding translocating proteins between the two components .

Interaction with Other TIM Complex Components

Tim-17 interacts with several other components of the mitochondrial protein import machinery. Recent findings have shown that Tim-17 is critical for the formation of the twin-pore structure of the Tim23 translocase and may act as a voltage sensor for this protein import complex . The first two transmembrane segments of Tim-17 are involved in interaction with the channel component Tim23, while the second two transmembrane segments interact with the import motor components .

A strictly conserved arginine residue at the matrix-facing side of the inner membrane plays an essential role in the recruitment of Tim44, an important component of the import motor . This suggests that Tim-17 coordinates the activities of the translocation channel and the import motor, facilitating efficient protein import.

Comparative Analysis with Tim-17 from Other Organisms

Understanding how Neurospora crassa Tim-17 compares to its homologs in other organisms provides valuable insights into the evolution and conservation of mitochondrial protein import mechanisms.

Tim-17 in Trypanosoma brucei

In Trypanosoma brucei, Tim-17 (TbTim17) has been more extensively studied than in Neurospora crassa. TbTim17 is the major component of the TIM complex in this organism and was identified through homology searches after the completion of the T. brucei genome sequence and mitochondrial proteome analysis . The protein is essential for parasite viability and is involved in mitochondrial protein import in both major developmental stages of T. brucei .

Unlike in other eukaryotes, T. brucei does not have additional homologs for Tim23 or Tim22, suggesting that TbTim17 may fulfill the functions of all these proteins . TbTim17 exists in large protein complexes ranging from 300 kDa to 1100 kDa and associates with multiple trypanosome-specific proteins, including TbTim62, TbTim42, TbTim54, TbTim50, and others .

Functional Diversity Across Species

While the core function of Tim-17 in mitochondrial protein import is conserved across species, there are notable differences in its specific roles and interactions. In T. brucei, for example, Tim-17 is also involved in the import of tRNAs into mitochondria, a function not observed in all organisms . Knockdown of TbTim17 reduces the levels of several nuclear-encoded mitochondrial tRNAs, indicating its role in this process .

The expression level of Tim-17 also varies across developmental stages in some organisms. In T. brucei, the protein is 6-7 fold more abundant in the procyclic form, which has a fully active mitochondrion, compared to the bloodstream form, where many mitochondrial activities are suppressed . This suggests that Tim-17 expression may be regulated according to mitochondrial activity levels.

Research Applications of Recombinant Tim-17

Recombinant Neurospora crassa Tim-17 serves as a valuable tool for various research applications in the field of mitochondrial biology and beyond.

Protein-Protein Interaction Analyses

Recombinant Tim-17 can be used in various protein-protein interaction assays, such as pull-down experiments, co-immunoprecipitation, and surface plasmon resonance, to identify and characterize its binding partners. These analyses can reveal the molecular mechanisms underlying Tim-17's role in coordinating the activities of different components of the TIM complex.

Development of Inhibitors and Therapeutic Applications

Understanding the structure and function of Tim-17 through studies with recombinant protein may lead to the development of specific inhibitors of mitochondrial protein import. Such inhibitors could have potential therapeutic applications, particularly in the treatment of diseases caused by parasites like Trypanosoma brucei, where Tim-17 has been shown to be essential for viability .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we will prioritize your specified tag type if provided. Please communicate your requirements.
Synonyms
tim17; NCU05623; Mitochondrial import inner membrane translocase subunit tim17
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
tim17
Target Protein Sequence
MDHTRDPCPWVILNDFGGAFAMGAIGGTIWHGIKGFRNSPYGERRIGAITAIKMRAPALG GNFGVWGGLFSTFDCAIKGLRNHKEDPWNSILAGFFTGGALAVRGGYKAARNGAIGCAVL LAVIEGVGIGFQKMLAGATKLEAPAPPPSNEKVLA
Uniprot No.

Target Background

Function
An essential component of the TIM23 complex, which facilitates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Database Links

KEGG: ncr:NCU05623

Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Tim-17 in mitochondrial protein import?

Tim-17 is an essential membrane-embedded subunit of the presequence translocase of the mitochondrial inner membrane (TIM23 complex), which represents the major route for importing nuclear-encoded proteins into mitochondria. Recent research has revealed that Tim-17, rather than Tim23 as previously believed, is the major subunit directly involved in the translocation of presequence proteins across the inner membrane . It contains conserved negative charges near the intermembrane space side of the bilayer that are essential to initiate the translocation process of presequence proteins through a distinct transmembrane cavity .

Tim-17 functions by providing a lateral cavity that forms a translocation path for proteins crossing the inner membrane. This pathway starts at the conserved negatively charged patch close to the intermembrane space side and continues through the cavity along the extended TM1 of Tim-17 to reach the mitochondrial matrix . This mechanism permits direct lateral release of transmembrane segments of inner membrane-sorted precursors into the inner membrane.

How does Tim-17 interact with other components of the mitochondrial import machinery?

Tim-17 interfaces with multiple components of the mitochondrial import machinery in functionally distinct ways. The first and second transmembrane segments (TM1 and TM2) of Tim-17 primarily mediate its interaction with Tim23, which together form a functional unit for precursor translocation . Mutations in these segments impair the Tim17-Tim23 interaction, affecting the formation of the translocation channel .

Conversely, the third transmembrane segment (TM3) of Tim-17 and the matrix-facing regions play a critical role in binding the import motor components . This spatial organization enables Tim-17 to effectively couple the channel components with the import motor, facilitating the handover of translocating proteins from the channel to the motor . Additionally, Tim-17 interacts with the C-terminal domain of Tim44, another essential component of the import motor, further emphasizing its role in coordinating the translocation process .

What experimental approaches are used to study Tim-17 function?

Researchers employ several complementary approaches to investigate Tim-17 function:

  • Site-specific chemical crosslinking: This technique maps the interactions between Tim-17 and translocating preproteins by introducing chemical crosslinkers at specific positions. For example, crosslinking studies with b2(84)-DHFR and b2(110)Δ-DHFR have demonstrated that Tim-17 directly interacts with both matrix-targeted and laterally sorted preproteins during their translocation .

  • Mutational analysis: Researchers create mutations in specific Tim-17 residues to assess their functional significance. Studies with Tim17 N64L and Tim17 S114L mutants revealed that hydrophilic residues within the lateral cavity are crucial for matrix protein translocation across the inner membrane . Similarly, mutations in the conserved negative charges (D17, D76, E126) demonstrated their essential nature for Tim-17 function .

  • Yeast genetics: Complementation studies in temperature-sensitive or conditional knockout yeast strains allow evaluation of different Tim-17 variants for their ability to support growth, revealing functionally critical regions and residues .

  • Protein purification and binding assays: Recombinant Tim-17 constructs are used in pull-down experiments to identify protein-protein interactions. This approach has revealed interactions between Tim-17 and components of the import motor, including Tim44 .

What is the structure of Tim-17 and how does it relate to its function?

Tim-17 belongs to the Tim17 protein family, which also includes Tim23 and Tim22. Structural modeling based on cryo-EM structures of Tim22 and AlphaFold predictions has revealed that Tim-17 consists of four transmembrane domains that form a curved surface, with a lateral cavity opening to the lipid bilayer .

This structure challenges the previous view of mitochondrial protein translocation. Neither Tim17, Tim23, nor Tim22 appear to form channels for precursor protein translocation across or insertion into the inner membrane as traditionally believed. Instead, the lateral cavity of Tim-17 plays a crucial role in guiding the presequence proteins across the inner membrane .

Key structural features include:

  • Conserved negative charges (D17, D76, E126) near the intermembrane space side of the bilayer, which are essential for initiating presequence protein translocation

  • Hydrophilic residues (N64, S114) within the lateral cavity that are crucial for matrix protein translocation

  • An extended TM1 that forms part of the translocation path from the intermembrane space to the matrix

The amphiphilic character of mitochondrial presequences directly matches this Tim17-dependent translocation mechanism .

What characterizes the Neurospora crassa Tim-17 compared to Tim-17 in other species?

While the search results provide limited specific information about Neurospora crassa Tim-17, they do mention that Tim9 is an essential protein in N. crassa . Tim proteins in general are highly conserved across species, with similar structural and functional characteristics.

The conserved features of Tim-17 across species include:

  • The four transmembrane domain structure with a lateral cavity

  • Conserved negative charges in the transmembrane regions that initiate presequence protein translocation

  • Functional interaction with Tim23 and the import motor components

In yeast (Saccharomyces cerevisiae), which has been extensively studied, mutations in the conserved Tim-17 negative charges (D17A_D76A_E126A) severely impair growth, confirming their essential nature across species . The high level of conservation suggests that the translocation mechanism at the Tim-17 bilayer interface is likely similar in Neurospora crassa and other eukaryotes.

How do mutations in the conserved negative charges of Tim-17 affect protein import efficiency?

Mutations in the conserved negative charges of Tim-17 have profound effects on protein import efficiency and cellular viability. Experimental evidence demonstrates a clear structure-function relationship:

When the conserved negative transmembrane charges of Tim-17 (D17, D76, E126) were mutated to alanine in various combinations, researchers observed distinct phenotypes based on the specific residues affected. The Tim17 D76A_E126A double mutant showed severely impaired growth on non-fermentable glycerol medium (YPG), while the Tim17 D17A_D76A and Tim17 D17A_E126A mutations produced even more pronounced growth defects . Most dramatically, the Tim17 D17A_D76A_E126A triple mutant displayed growth comparable to the empty vector control, confirming that these conserved negative transmembrane charges are essential for viability .

The mechanistic explanation for these defects lies in the role these negative charges play in the protein import process. Located near the intermembrane space side of the lateral cavity, these residues form a translocation initiation site (TIS) that interacts with the positively charged presequences of importing proteins. The negative charges essentially create an electrostatic interaction that guides the positively charged presequences into the translocation pathway . When these charges are neutralized through alanine substitutions, the electrostatic interaction is disrupted, severely compromising the initial recognition and engagement of presequence proteins.

Import assays with isolated mitochondria from the Tim17 D17A_D76A mutant showed dramatically reduced import of matrix-targeted preproteins compared to wild-type, while the assembly of the carrier protein Dic1 (which depends on the TIM22 complex) remained unaffected . This selective import defect confirms that the conserved negative charges specifically mediate the translocation of presequence proteins.

What evidence supports the lateral cavity model for Tim-17-mediated protein translocation?

The lateral cavity model for Tim-17-mediated protein translocation is supported by multiple lines of converging evidence, challenging the prevailing channel-based paradigm:

  • Site-specific crosslinking studies: Systematic analysis using cysteine-specific crosslinking revealed that arrested precursor proteins associate along the lateral cavity of Tim17, from D76 (located on the intermembrane space side within the lateral cavity in TM2), through N64 (hydrophilic residue in the middle of Tim17-TM2), to K36 (a residue at the matrix side of the lateral cavity in Tim17-TM1) . This spatial pattern maps the pathway of translocating preproteins through the Tim-17 structure.

  • Functional importance of cavity residues: Mutations of hydrophilic residues within the lateral cavity (N64L, S114L) specifically impaired the import of matrix-targeted presequence proteins without affecting inner membrane protein sorting or carrier protein assembly . This selective effect suggests these residues line a functional translocation pathway critical for matrix protein import.

  • Structural models: Modeling of Tim-17 based on cryo-EM structures of Tim22 and AlphaFold predictions reveals a curved surface with a lateral cavity opening to the lipid bilayer, inconsistent with a traditional channel structure . This architecture is better suited for guiding proteins along a membrane interface rather than through an aqueous pore.

  • Correlation of crosslinking efficiency with Tim-17 activity: In temperature-sensitive tim17-mutant mitochondria, researchers observed a strong reduction in precursor protein-Tim17 crosslinking after heat shock, indicating that crosslinking directly correlates with Tim-17 activity . This provides functional validation for the direct involvement of Tim-17 in the translocation process.

Collectively, these findings support a model where presequence proteins are translocated across the inner membrane at the Tim-17 bilayer interface rather than through a conventional aqueous channel. The amphiphilic nature of mitochondrial presequences is particularly well-suited for this translocation mechanism, as it allows interaction with both the hydrophilic residues in the cavity and the surrounding lipid environment .

How do Tim-17 and Tim-23 cooperate during protein translocation, and what distinguishes their functions?

The cooperation between Tim-17 and Tim-23 during protein translocation involves distinct functional contributions that together enable efficient protein import:

Tim-17 and Tim-23 form a heterodimeric core of the presequence translocase, but with specialized roles. Contrary to previous assumptions, recent evidence indicates that Tim-17, not Tim-23, is the major subunit directly involved in presequence protein translocation across the inner membrane . Tim-17 provides the lateral cavity through which presequence proteins are translocated, with its conserved negative charges serving as an initial recognition site for positively charged presequences .

The functional interface between these proteins has been mapped through mutational studies. The first and second transmembrane segments (TM1 and TM2) of Tim-17 mediate its interaction with Tim-23, forming the structural foundation of the translocation apparatus . Mutations in these regions impair this interaction, affecting the integrity of the translocase complex .

The current evidence suggests a back-to-back conformation of the Tim17-Tim23 heterodimer as a functional unit for precursor translocation . In this arrangement, Tim-17 provides the main translocation interface, while Tim-23 likely contributes to the initial recognition of presequences and structural stability of the complex.

This revised understanding of the Tim17-Tim23 relationship helps explain previously puzzling observations and provides a more coherent model for how presequence proteins navigate the inner membrane during import.

What methods are most effective for expressing and purifying recombinant Neurospora crassa Tim-17 for structural studies?

For structural studies of mitochondrial membrane proteins like Tim-17, researchers typically employ the following approaches:

  • Expression systems: E. coli-based expression systems using specialized strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) can be effective. For Tim proteins, the search results mention successful recombinant expression of various Tim44 constructs, which were subsequently purified for functional studies . A similar approach could be adapted for Tim-17.

  • Purification strategies: The search results describe coupling purified protein constructs to CNBr-Sepharose beads for pull-down experiments . For structural studies, additional purification steps would be necessary. Membrane proteins like Tim-17 typically require:

    • Solubilization with appropriate detergents (e.g., n-Dodecyl β-D-maltoside (DDM) or digitonin)

    • Immobilized metal affinity chromatography (IMAC) using engineered affinity tags

    • Size exclusion chromatography to achieve high purity and homogeneity

  • Protein stability: The search results indicate that for the Tim9·Tim10 complex (another component of the mitochondrial import machinery), zinc influences the integrity of the purified complex . While not directly applicable to Tim-17, this highlights the importance of identifying stabilizing factors for purified Tim proteins.

  • Structural analysis techniques: For membrane proteins like Tim-17, cryo-electron microscopy (cryo-EM) has emerged as a powerful technique, as evidenced by its use in determining structures of related proteins such as Tim22 . X-ray crystallography remains challenging but possible with appropriate crystallization conditions.

For functional validation of the purified protein, binding assays similar to those described for Tim44 constructs could be employed, where the purified protein is used to identify interaction partners from solubilized mitochondria .

How does the mechanism of Tim-17-mediated protein import relate to the pathogenesis of mitochondrial diseases?

While the search results don't directly address the relationship between Tim-17 and mitochondrial diseases, we can draw connections based on the central role of Tim-17 in mitochondrial protein import:

The recent discovery that Tim-17 is the major subunit directly involved in presequence protein translocation across the inner membrane has significant implications for understanding mitochondrial diseases . Approximately 60% of over 1,000 different mitochondrial proteins are synthesized with amino-terminal targeting signals (presequences) and require the TIM23 complex for their import . Defects in this machinery could therefore affect a substantial portion of the mitochondrial proteome.

Several mechanisms can link Tim-17 dysfunction to mitochondrial pathology:

  • Impaired energy production: Many matrix-targeted proteins are components of the respiratory chain complexes or TCA cycle. The Tim-17 N64L and Tim-17 S114L mutations specifically exhibited strong import defects of matrix-targeted presequence proteins . Similar defects in humans could compromise energy production, a common feature of mitochondrial diseases.

  • Protein mislocalization: Tim-17 sorts presequence proteins to either the inner membrane or matrix . Dysfunction could lead to protein mislocalization, potentially creating proteotoxic stress and triggering mitochondrial quality control pathways.

  • Developmental impacts: The essential nature of Tim-17, demonstrated by the severe growth defects of yeast strains with mutations in conserved negative charges , suggests that significant dysfunction would be incompatible with embryonic development in higher organisms. More subtle defects might contribute to tissue-specific manifestations of mitochondrial disease, particularly affecting high-energy tissues.

  • Stress response: The import machinery adapts to cellular stress conditions. Alterations in Tim-17 function could impair this adaptability, contributing to cellular vulnerability during metabolic or oxidative stress.

Given the fundamental importance of protein import for mitochondrial function, further investigation of Tim-17 variants in patients with unexplained mitochondrial disease phenotypes may yield valuable insights into disease mechanisms and potential therapeutic approaches.

What are the optimal conditions for studying Tim-17 interactions with translocating preproteins?

Studying Tim-17 interactions with translocating preproteins requires specific experimental conditions that maintain the functional state of the protein import machinery while allowing detection of transient interactions. Based on the search results, the following approaches have proven effective:

  • Arrested translocation intermediates: To capture the dynamic process of protein translocation, researchers generate translocation intermediates by using model preproteins that can be arrested during import. For example, b2(84)-DHFR and b2(110)Δ-DHFR constructs have been successfully used to accumulate preproteins in TOM-TIM23 import sites . The DHFR domain can be locked in a folded conformation with methotrexate, preventing complete translocation.

  • Chemical crosslinking: Site-specific chemical crosslinking provides spatial information about protein-protein interactions during translocation. The search results describe how researchers employed this technique to map interactions between Tim-17 and preproteins:

    • Optimal crosslinker selection depends on the distance between interacting residues

    • Temperature and pH conditions should preserve the native state of the import machinery (typically pH 7.2-7.4, 25-30°C)

    • Crosslinking efficiency directly correlates with Tim-17 activity, providing functional validation

  • Genetic incorporation of crosslinking sites: Introducing specific residues (often cysteines) at defined positions in both Tim-17 and preproteins enables precise mapping of interaction interfaces. This approach revealed that arrested precursor proteins associate along the lateral cavity of Tim17 from D76 through N64 to K36 .

  • Isolated mitochondria system: In vitro import assays using isolated mitochondria provide a controlled environment that maintains the membrane potential necessary for preprotein import . The integrity of the inner membrane and the presence of a membrane potential (Δψ) are essential for studying physiologically relevant interactions .

  • Temperature conditions: For temperature-sensitive Tim-17 mutants, controlled heat shock (typically 37°C for yeast mitochondria) can be used to selectively inactivate Tim-17 function, providing a negative control for interaction studies .

These methodological approaches have collectively enabled the recent paradigm shift in understanding Tim-17's central role in preprotein translocation across the mitochondrial inner membrane.

What techniques are recommended for analyzing the conformational changes in Tim-17 during protein import?

Analyzing conformational changes in Tim-17 during protein import presents significant technical challenges due to the dynamic nature of the process and the membrane-embedded location of the protein. Based on approaches used in recent studies, the following techniques are recommended:

  • Site-directed crosslinking with conformationally sensitive probes: By strategically placing crosslinking residues (typically cysteines) within different regions of Tim-17, researchers can detect conformational changes that alter the accessibility or proximity of these residues during different stages of protein import . The search results describe how this approach successfully mapped the translocation path through Tim-17's lateral cavity .

  • EPR spectroscopy: Although not explicitly mentioned in the search results, electron paramagnetic resonance (EPR) spectroscopy with site-directed spin labeling is highly suitable for membrane proteins like Tim-17. This technique can detect changes in side-chain mobility, accessibility, and inter-residue distances that accompany conformational changes.

  • FRET analysis: Fluorescence resonance energy transfer between strategically placed fluorophores can report on distance changes between different regions of Tim-17 or between Tim-17 and partner proteins during the import process. The efficiency of energy transfer provides quantitative information about conformational dynamics.

  • Accessibility studies: Chemical modification of engineered cysteine residues can reveal changes in solvent exposure during different functional states. By comparing modification patterns under conditions that promote or inhibit specific steps of import, conformational transitions can be inferred.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): While challenging for membrane proteins, this technique can provide insights into changes in protein dynamics and solvent accessibility during functional cycles.

  • Comparative mutation analysis: The search results describe how mutations in different regions of Tim-17 selectively affect different aspects of import . By systematically analyzing these functional effects, researchers can infer the conformational requirements for specific steps in the import process.

  • Cryo-EM of different functional states: The search results mention the use of cryo-EM structures as templates for modeling Tim-17 . Capturing the complex in different functional states could provide direct structural evidence of conformational changes.

These approaches, especially when used in combination, can provide complementary information about how Tim-17 changes conformation to facilitate different steps of preprotein translocation across the mitochondrial inner membrane.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.