Recombinant Neurospora crassa Mitochondrial import inner membrane translocase subunit tim-21 (tim-21)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Properties

Recombinant Neurospora crassa mitochondrial import inner membrane translocase subunit Tim-21 (Tim-21) is a protein subunit critical for mitochondrial protein import. Its full-length form (52–251 amino acids) is fused to an N-terminal His-tag for purification and functional studies . Expressed in E. coli, it retains structural and functional fidelity for research applications, including structural biology and biochemical assays . The protein is annotated under UniProt ID Q7S8S5 and participates in the TIM23 complex, which translocates presequence-containing proteins into the mitochondrial matrix .

Role in Mitochondrial Protein Import

Tim-21 bridges the TOM and TIM23 complexes, facilitating the transfer of presequence-containing proteins from the mitochondrial outer membrane to the inner membrane . This process involves:

  1. Recognition: Tim-21 binds the IMS domain of Tom22 via electrostatic interactions.

  2. Translocation: The TIM23 complex mediates inner membrane translocation, driven by membrane potential .

  3. Regulation: Presequence competition with Tim-21 for Tom22 binding modulates import efficiency .

Research Applications

The recombinant Tim-21 protein is utilized in:

  • Structural Studies: Crystallization of its binding domain revealed novel α/β-folds, informing TIM23 complex dynamics .

  • Functional Assays: His-tagged Tim-21 enables pull-down experiments to study interactions with Tom22 or TIM23 components .

  • Disease Modeling: While not directly linked to human diseases, insights into Tim-21’s role in mitochondrial biogenesis inform studies on disorders like optic atrophy (e.g., human TIMM21) .

Comparative Analysis

AspectNeurospora Tim-21Human TIMM21
FunctionTIM23 complex subunitPart of TIM23 complex; regulates complex I/IV assembly
StructureMembrane anchor + IMS-binding domainSimilar topology with conserved binding motifs
Disease AssociationNone reportedOptic atrophy 12, combined OXPHOS deficiency
Key InteractionsTom22, TIM23 componentsMITRAC complex, respiratory chain subunits

While functional homology exists, Neurospora Tim-21 lacks direct human disease associations but serves as a model for studying mitochondrial import mechanisms .

Table 2: Key Functional Interactions of Tim-21

Interaction PartnerBinding RegionMechanismSource
Tom22 (IMS domain)Negatively charged residuesElectrostatic complementarity
TIM23 ComplexMembrane anchorStructural stabilization
Presequence PeptidesIMS domainCompetitive binding

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tim21; NCU08810; Mitochondrial import inner membrane translocase subunit tim21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
52-251
Protein Length
Full Length of Mature Protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
tim21
Target Protein Sequence
ATTQESSKRRSVTPFNDDGHVPWTRLSTGEKAGRAVQQTFNFGLVILGVVLTGGIAYLLF TDVFSPESKTAYFNRAVDRIRADPRCVALLSPGDPKKIAAHGEETHNKWRRARPIAATVE KDNRGVEHLKMHFHVEGPRGSGVVGLHLTKQPGHWEHEYQTFYVDVRGHQRIYLENKEAE VAAAKKGGNKEFKFLGVKWN
Uniprot No.

Target Background

Function

TIM-21 is an essential component of the TIM23 complex, mediating the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. It maintains close contact between the TOM and TIM23 complexes. Subsequently, it dissociates from the TOM23 complex to enable protein translocation into the mitochondrial matrix.

Database Links

KEGG: ncr:NCU08810

Protein Families
TIM21 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the structural composition of Neurospora crassa Tim-21?

Neurospora crassa Tim-21 is a subunit of the presequence translocase of the inner mitochondrial membrane (the TIM23 complex). The protein consists of a membrane anchor domain embedded in the inner mitochondrial membrane and a carboxy-terminal domain that extends into the intermembrane space . This C-terminal domain is functionally critical as it serves as the binding domain that directly connects the TOM (translocase of the outer membrane) and TIM23 complexes by interacting with the intermembrane space domain of the Tom22 receptor . The protein's structure enables it to function as a molecular bridge between the two main translocase complexes involved in mitochondrial protein import.

How does Tim-21 contribute to mitochondrial protein import in Neurospora crassa?

Tim-21 plays a pivotal role in the import pathway for proteins bearing N-terminal presequences. The protein facilitates the transfer of precursor proteins from the TOM complex to the TIM23 complex across the intermembrane space . This process is essential for the approximately 1,000 different precursor proteins that must be imported from the cytosol into mitochondria . The mechanism involves:

  • Initial recognition and translocation of preproteins through the TOM complex

  • Tim-21-mediated connection between TOM and TIM23 complexes via its interaction with Tom22

  • Transfer of preproteins to the TIM23 complex

  • Further translocation into or across the inner membrane via the TIM23 complex

  • For matrix-destined proteins, the presequence translocase-associated motor complex (PAM) drives completion of translocation

These steps ensure efficient and specific targeting of nuclear-encoded mitochondrial proteins to their correct submitochondrial locations .

What experimental evidence confirms Tim-21 function in Neurospora crassa?

While direct experimental evidence for N. crassa Tim-21 is limited in the provided sources, research approaches can be inferred from related studies. The functional characterization of mitochondrial import components typically employs:

  • Genetic approaches: Creation of knockout or conditional mutants to study the effects of Tim-21 absence or dysregulation, similar to studies of the cyt-21 mutant

  • Protein interaction studies: Using techniques such as co-immunoprecipitation or crosslinking to identify binding partners

  • Structural analysis: Crystallization of protein domains, as mentioned for the binding domain of Tim-21

  • In vitro import assays: Reconstitution of import activity using isolated mitochondria and radiolabeled precursor proteins

These experimental approaches collectively provide complementary lines of evidence for understanding Tim-21's functional role in the mitochondrial protein import machinery of N. crassa.

What are the optimal strategies for recombinant expression of Neurospora crassa Tim-21?

Recombinant expression of N. crassa Tim-21 can be optimized using several approaches based on principles established for other recombinant proteins:

  • Codon optimization focusing on translation initiation sites: Analysis of 11,430 recombinant protein production experiments reveals that optimizing the accessibility of translation initiation sites significantly improves expression success . For Tim-21, this would involve modifying the first 4-9 codons with synonymous substitutions to enhance mRNA base-unpairing across the Boltzmann's ensemble .

  • Expression system selection: E. coli is often used for initial expression attempts, but given Tim-21's membrane-associated nature, eukaryotic expression systems may be more suitable to ensure proper folding and post-translational modifications.

  • Fusion tag strategies: Incorporating solubility-enhancing tags (such as MBP or SUMO) or affinity tags (His, GST) can improve both expression and purification outcomes.

  • Expression temperature adjustment: Lower temperatures (16-20°C) often improve the folding and solubility of challenging membrane-associated proteins.

The TIsigner web application (https://tisigner.com/tisigner) can be used to tune Tim-21 expression through engineering minimal synonymous codon changes in translation initiation sites .

How can researchers overcome challenges in purifying functional Tim-21?

Purification of functional Tim-21 presents several challenges due to its membrane association. Methodological approaches include:

  • Detergent screening: Systematic testing of multiple detergents (mild non-ionic detergents like DDM or LMNG) to solubilize Tim-21 while maintaining its native conformation.

  • Amphipol or nanodisc reconstitution: Transferring detergent-solubilized Tim-21 into more stable membrane mimetics for structural and functional studies.

  • Domain-based approaches: Expression and purification of the soluble intermembrane space domain separately, as was done for crystallization studies .

  • Co-expression strategies: Co-expressing Tim-21 with interaction partners like Tom22 fragments may stabilize the protein during expression and purification.

  • On-column refolding: For proteins expressed in inclusion bodies, controlled refolding during affinity purification can sometimes restore functionality.

Each purification attempt should be followed by functional validation, such as binding assays with the IMS domain of Tom22, to ensure the purified protein retains its native activity.

What regulatory mechanisms govern Tim-21 expression in response to mitochondrial function in Neurospora crassa?

Drawing parallels with other mitochondrial proteins in N. crassa, Tim-21 expression likely responds to mitochondrial functional status through regulatory mechanisms similar to those observed for the cyt-21 gene. The cyt-21 gene shows a 5-fold increase in mRNA levels when mitochondrial protein synthesis is inhibited . This suggests a general mechanism for coordinately activating nuclear genes encoding mitochondrial constituents in response to impaired mitochondrial function .

Potential regulatory mechanisms may include:

  • Retrograde signaling pathways: Communication from mitochondria to the nucleus to adjust nuclear gene expression based on mitochondrial functional status

  • Transcription factor networks: Specific transcription factors may recognize motifs in the promoters of nuclear genes encoding mitochondrial proteins

  • Post-transcriptional regulation: mRNA stability or translation efficiency may be regulated in response to mitochondrial dysfunction

  • Circadian control: Some mitochondrial genes in N. crassa are subject to circadian regulation , suggesting Tim-21 might also be regulated in a time-dependent manner

Researchers studying Tim-21 regulation should consider these potential mechanisms and design experiments to investigate the specific pathways governing its expression.

How can advanced imaging techniques be applied to study Tim-21 localization and dynamics?

Understanding Tim-21 localization and dynamics within mitochondria requires sophisticated imaging approaches:

  • Super-resolution microscopy: Techniques such as STED, PALM, or STORM can resolve Tim-21 localization beyond the diffraction limit, potentially visualizing its distribution within the inner membrane and at contact sites between inner and outer membranes.

  • Live-cell imaging with photo-convertible fluorescent proteins: Tagging Tim-21 with mEos or Dendra2 allows for pulse-chase experiments to track newly synthesized protein and determine turnover rates.

  • FRET-based interaction studies: Fluorescent protein pairs attached to Tim-21 and potential interaction partners (e.g., Tom22) can reveal spatial proximity and dynamics of interactions in living cells.

  • Correlative light and electron microscopy (CLEM): Combining fluorescence microscopy with electron microscopy provides both molecular specificity and ultrastructural context for Tim-21 localization.

  • Single-molecule tracking: Techniques like HILO or light sheet microscopy with single-molecule sensitivity can track individual Tim-21 molecules to reveal diffusion characteristics and binding kinetics.

These advanced imaging approaches should be combined with appropriate controls and quantitative analysis to yield meaningful insights into Tim-21 biology.

What strategies can optimize mRNA accessibility for enhanced recombinant Tim-21 production?

Optimizing mRNA accessibility at translation initiation sites represents a powerful approach for enhancing Tim-21 expression. Based on extensive recombinant protein production experiments, the following table summarizes key optimization parameters :

Optimization ParameterImplementation StrategyExpected Impact on Tim-21 Expression
Number of codons to modifyFirst 4-9 codons from startSufficient for significant expression improvement
Target accessibility valueMinimize opening energyHigher accessibility correlates with higher expression
Codon adaptationMaintain usage bias of hostPrevents rare codon bottlenecks during translation
5'UTR selectionT7lac promoter with optimized spacingProvides reliable expression platform
Expression score tuningAdjust using TIsigner toolAllows calibration of expression level

The simulated annealing approach implemented in the TIsigner web application provides an efficient method for identifying optimal synonymous substitutions . This approach begins with more aggressive changes at higher computational "temperatures" and gradually refines to smaller changes as the algorithm progresses toward an optimum solution. Multiple parallel simulations can produce several alternative sequence solutions, allowing researchers to select candidates with desired properties.

How should researchers design experiments to investigate Tim-21 interactions with the mitochondrial import machinery?

Investigation of Tim-21 interactions requires a multi-faceted experimental approach:

  • In vitro binding assays: Purified recombinant Tim-21 (particularly its intermembrane space domain) can be tested for direct binding to potential partners like Tom22 using techniques such as surface plasmon resonance (SPR), microscale thermophoresis (MST), or isothermal titration calorimetry (ITC). These provide quantitative binding parameters including affinity constants and thermodynamic values.

  • Pull-down experiments: GST-tagged or His-tagged Tim-21 can be used to capture interacting proteins from mitochondrial extracts, followed by mass spectrometry identification of binding partners.

  • Crosslinking coupled with mass spectrometry: Chemical crosslinking followed by MS analysis can identify proximity relationships and interaction interfaces between Tim-21 and other components of the import machinery.

  • Genetic interaction studies: Synthetic genetic arrays or targeted genetic crosses between tim-21 mutants and mutants in other import components can reveal functional relationships.

  • Structural biology approaches: X-ray crystallography or cryo-EM studies of Tim-21 alone or in complex with interaction partners can provide atomic-level details of binding interfaces, as mentioned for the Tim21 binding domain .

Each approach has strengths and limitations, making a combination of methods the most robust strategy for comprehensively mapping Tim-21 interactions.

What controls should be included when studying the impact of tim-21 mutations on mitochondrial function?

Rigorous experimental design for studying tim-21 mutations requires careful consideration of controls:

  • Genetic controls:

    • Wild-type strain grown under identical conditions

    • Complemented mutant strain (tim-21 mutant with wild-type gene reintroduced)

    • Mutations in other TIM complex components for comparison

    • Allelic series of tim-21 mutations (null, hypomorphic, domain-specific)

  • Phenotypic analyses:

    • Growth rate measurements under various carbon sources

    • Mitochondrial morphology assessment

    • Membrane potential measurements

    • Oxygen consumption rates

    • Import efficiency of various substrate proteins

  • Biochemical controls:

    • Verification of Tim-21 expression levels in all strains

    • Assessment of steady-state levels of other import machinery components

    • Import assays with multiple different substrate proteins

    • Controls for mitochondrial isolation quality and integrity

  • Environmental variables:

    • Temperature sensitivity tests

    • Carbon source variation

    • Oxidative stress challenges

    • Circadian time point controls if tim-21 shows circadian regulation

This comprehensive approach ensures that observed phenotypes can be confidently attributed to specific tim-21 functions rather than secondary effects or experimental artifacts.

How can researchers differentiate between direct and indirect effects of Tim-21 deficiency?

Distinguishing direct from indirect effects of Tim-21 deficiency requires methodological rigor:

  • Temporal analysis: Examining the time course of events following Tim-21 depletion or inactivation can help identify primary (rapid) versus secondary (delayed) effects. Inducible expression systems or degradation tags allow precise temporal control.

  • Substrate specificity profiling: Testing import efficiency of multiple different precursor proteins with varying targeting signals can reveal which import pathways are specifically affected by Tim-21 deficiency.

  • Structure-function analysis: Creating a series of Tim-21 variants with specific domains mutated or deleted can link particular protein regions to specific functions and phenotypes.

  • Suppressor screening: Identifying genetic suppressors of tim-21 mutant phenotypes can reveal functionally related components and pathways.

  • Comparative analysis: Examining the consequences of deficiencies in other import components (e.g., other TIM23 complex subunits) helps differentiate Tim-21-specific effects from general mitochondrial import defects.

  • In vitro reconstitution: Reconstituting specific import steps with purified components allows direct testing of Tim-21's role in defined biochemical processes.

By systematically applying these approaches, researchers can build a comprehensive understanding of direct Tim-21 functions versus downstream consequences of primary defects.

What computational approaches can predict the impact of mutations on Tim-21 function?

Several computational approaches can predict mutational effects on Tim-21:

  • Structural modeling and molecular dynamics: Using the crystallized binding domain structure as a starting point, homology modeling and molecular dynamics simulations can predict how mutations might affect protein stability and interaction interfaces.

  • Evolutionary conservation analysis: Identifying evolutionarily conserved residues across diverse species can highlight functionally critical regions where mutations are likely to be deleterious.

  • Machine learning-based prediction tools: Tools like SIFT, PolyPhen-2, or PROVEAN can predict the functional impact of amino acid substitutions based on trained algorithms.

  • Coevolution analysis: Statistical coupling analysis or direct coupling analysis can identify co-evolving residue networks that maintain protein function, predicting which residue combinations might preserve activity.

  • Energy-based calculations: Computing changes in folding free energy upon mutation can predict stability effects, while changes in binding free energy can predict effects on protein-protein interactions.

These computational approaches should be validated experimentally, but they provide valuable guidance for designing targeted mutations and interpreting unexpected phenotypes in experimental systems.

How might circadian regulation influence Tim-21 expression and function in Neurospora crassa?

The potential circadian regulation of Tim-21 represents an intriguing research direction, based on evidence that some mitochondrial genes in N. crassa are subject to circadian control . Future research should explore:

  • Temporal expression profiling: Quantitative RT-PCR or RNA-Seq analysis of tim-21 transcript levels across a 24-hour cycle under constant darkness to identify potential circadian oscillations.

  • Promoter analysis: Examination of the tim-21 promoter region for circadian clock-responsive elements similar to those found in other clock-controlled genes (ccgs) in N. crassa.

  • Interaction with clock machinery: Chromatin immunoprecipitation (ChIP) experiments to determine if core clock transcription factors bind to the tim-21 promoter.

  • Functional consequences: Investigation of whether mitochondrial protein import efficiency varies with circadian time and how this relates to metabolic demands that fluctuate throughout the day.

  • Clock mutant analysis: Examination of tim-21 expression patterns in frq, wc-1, or wc-2 mutant backgrounds to determine dependency on core clock components.

This research direction could reveal important links between circadian regulation, mitochondrial function, and cellular energy metabolism in N. crassa.

What novel approaches could enhance our understanding of Tim-21's role in coordinating mitochondrial biogenesis?

Several innovative approaches could advance our understanding of Tim-21's broader role:

  • Proximity-based proteomics: BioID or APEX2 tagging of Tim-21 to identify the complete interactome in living cells, potentially revealing unexpected non-canonical functions.

  • Single-cell analysis: Examining cell-to-cell variation in Tim-21 levels and correlating with mitochondrial function parameters could reveal regulatory principles not apparent in population averages.

  • In situ structural biology: Emerging techniques like cryo-electron tomography of cellular sections could reveal Tim-21's organization within the native mitochondrial membrane environment.

  • Metabolic profiling: Comprehensive metabolomic analysis of tim-21 mutants could reveal unexpected metabolic consequences and functional connections.

  • Integration with systems biology: Incorporating Tim-21 data into computational models of mitochondrial biogenesis and function could predict emergent properties and generate testable hypotheses.

  • Synthetic biology approaches: Designing artificial mitochondrial import systems with engineered Tim-21 variants could reveal design principles and essential functional features.

These approaches extend beyond traditional biochemical and genetic techniques to provide a more comprehensive understanding of Tim-21's role in the complex process of mitochondrial biogenesis and maintenance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.