Recombinant Neurospora crassa NADH-cytochrome b5 reductase 2 (mcr-1)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Catalytic Activity

Enzyme Function

  • Catalytic Role: Transfers electrons from NADH to cytochrome b5, facilitating redox reactions in lipid metabolism and ROS detoxification .

  • EC Number: 1.6.2.2 (NADH:ferricytochrome-b5 oxidoreductase) .

Kinetic Parameters

SubstrateApparent K<sub>m</sub>V<sub>max</sub>pH Optimum
NADH~2 μM (analogous systems) Not reported6.0–8.0
Cytochrome b5~14 μM (analogous systems) Not reported

Cofactor Dependency

  • Requires FAD for activity, with characteristic absorption peaks at 460 nm (FAD-derived) .

Recombinant Production and Purification

Expression System

  • Host: E. coli .

  • Vector: pUC13 or similar, with thrombin-cleavable fusion tags .

Purification and Stability

ParameterSpecification
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based, 6% trehalose, pH 8.0
StabilityStable at -80°C; avoid freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water + 50% glycerol

Research Applications and Findings

Mutagenesis Studies

  • Coenzyme Specificity: Substitution of Ser920→Asp in homologous systems reversed NADPH/NADH preference by 6,000-fold, highlighting residue-level engineering potential .

  • Structural Stability: Deletion mutations (e.g., ΔLys173-Ser174-Val175) disrupt catalytic residues (Cys203/His204), causing severe functional deficits .

Disease Relevance

  • While Neurospora mcr-1 is not directly linked to human disease, mutations in homologous human NADH-cytochrome b5 reductases (e.g., CYB5R3) cause methemoglobinemia and neurological disorders .

Biotechnological Utility

  • Used to study electron transfer mechanisms in lipid rafts and cholesterol synthesis .

  • Serves as a model for engineering redox enzymes with altered cofactor specificity .

Evolutionary and Functional Homology

Cross-Species Homologs

SpeciesGeneProtein IdentityFunction
Saccharomyces cerevisiaeMCR135%Mitochondrial redox balance
Oryza sativaOs01g017430028%Stress response
Homo sapiensCYB5R330%Erythrocyte redox homeostasis
Source:

Future Directions

  • Structural Resolution: Cryo-EM or X-ray crystallography to elucidate full 3D architecture.

  • Metabolic Engineering: Optimizing mcr-1 for industrial NADH recycling systems .

  • Disease Modeling: Leveraging fungal homologs to study human CYB5R3-linked disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement. We will accommodate your request as much as possible.
Lead Time
Delivery times may vary based on the purchasing method and location. Kindly consult your local distributor for specific delivery information.
Note: All proteins are shipped standard with blue ice packs. If dry ice shipping is required, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mcr-1; NCU03112; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
mcr-1
Target Protein Sequence
MSLFVASTRSAFRAAAPIKRSFQTRRSYATEPSKGGSSSTILLGAAAVGLAGAGAYFFSG AGAAKKAEASVKQVTEKITPGEIKKAFVGGDQGWLSLKLEEVELVNHNTKRLRFRLPEDD MVSGLHVASAILTKFKPIDAEKAVLRPYTPISDESAQGYIDLLVKKYEGGPMSTYLHDMA PGQRLDIKGPLPKYPWEANKHKHIALVAGGTGITPMYQLIRAIFNNPDDKTKVTLVFGNV SEEDVLLKHELATIENHYPQRFRAFYVLDNPPKEWAGNKGYINKDLLKTVLPEPKNEDIK IFVCGPPGMMNSISGNKKSPRDQGELTGILKELGYSPDQVYKF
Uniprot No.

Target Background

Function
This protein may mediate the reduction of outer membrane cytochrome b5.
Database Links

KEGG: ncr:NCU03112

Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is the relationship between NADH-cytochrome b5 reductase in fungi and the bacterial MCR-1 gene?

Despite similar nomenclature, these represent distinct biological entities. In fungi like Saccharomyces cerevisiae, the MCR1 gene encodes NADH-cytochrome b5 reductase, which functions in electron transport and oxidative stress response . In contrast, the bacterial MCR-1 gene (with hyphen) confers resistance to colistin, a last-resort antibiotic, in bacteria like Escherichia coli . This bacterial gene has been detected in multiple countries and represents a significant public health concern due to its plasmid-mediated transfer mechanism . Researchers must be careful not to confuse these distinct systems when designing experiments or interpreting literature.

How is NADH-cytochrome b5 reductase characterized in Neurospora crassa compared to other fungi?

While the search results don't directly characterize this enzyme in N. crassa, comparative genomic analysis suggests conservation across fungal species. In S. cerevisiae, two types of cytochrome b5 reductases have been identified: CBR (showing similarity to plant nitrate reductases and mammalian cytochrome b5 reductases) and MCR1 (localized to mitochondria in two forms) . N. crassa likely possesses homologous enzymes with similar functions, though the exact nomenclature may differ. The transcriptional regulator rca-1 in N. crassa has been shown to be involved in lignocellulolytic enzyme synthesis when grown on plant biomass , but this is distinct from cytochrome b5 reductase function.

What is the structural organization of fungal NADH-cytochrome b5 reductase genes?

The gene structure of fungal NADH-cytochrome b5 reductase typically contains multiple introns. In Mortierella alpina, the genomic gene for cytochrome b5 reductase contains four introns of varying sizes, all following the GT-AG rule (GT at the 5' end and AG at the 3' end) . The cDNA from M. alpina encodes a protein of 298 amino acid residues, showing significant sequence similarity to cytochrome b5 reductases from yeast, bovine, human, and rat sources . Based on sequence conservation patterns, N. crassa likely has a similar gene organization, though specific intron positions may vary.

What role does NADH-cytochrome b5 reductase play in oxidative stress response?

Studies in S. cerevisiae demonstrate that NADH-cytochrome b5 reductase plays a crucial role in the response to oxidative damage. Disruption of the MCR1 gene results in hypersensitivity to hydrogen peroxide and menadione, while overexpression increases resistance to oxidative stress . The enzyme functions specifically as NADH-D-erythroascorbyl free radical reductase, playing a key role in the NADH-dependent reduction of D-erythroascorbyl free radical . The intracellular level of D-erythroascorbic acid in mcr1 disruptant cells was approximately 11% of that in wild-type strains, highlighting the enzyme's importance in maintaining cellular redox balance . Similar functions would be expected in N. crassa, potentially with adaptations specific to its ecological niche.

How do electron transport pathways involving NADH-cytochrome b5 reductase differ between fungi and mammals?

In mammalian microsomes, two electron transport pathways exist: an NADH-linked system (consisting of cytochrome b5 reductase, cytochrome b5, and fatty acid desaturase) and an NADPH-linked system (consisting of NADPH-cytochrome P-450 reductase and cytochrome P-450) . Cytochrome b5 serves as an electron donor to oxygenated cytochrome P-450 in the NADPH-dependent oxidation of xenobiotics . In fungi, while similar pathways exist, the specific interactions and relative importance of these pathways may differ. The exact configuration of these pathways in N. crassa remains to be fully characterized.

How can gene disruption studies inform our understanding of cytochrome b5 reductase function?

Gene disruption experiments in S. cerevisiae have revealed that CBR (one type of cytochrome b5 reductase) is essential for life . Similarly, disruption of the MCR1 gene significantly impacts D-erythroascorbic acid levels and sensitivity to oxidative stress . In N. crassa, analogous gene disruption studies would be valuable for determining the essentiality and specific functions of its cytochrome b5 reductase genes. Such studies could employ CRISPR-Cas9 or traditional homologous recombination approaches to generate knockout strains.

What expression systems are optimal for producing recombinant fungal NADH-cytochrome b5 reductase?

Based on research with M. alpina cytochrome b5 reductase, expression in filamentous fungi like Aspergillus oryzae has proven successful, resulting in a 4.7-fold increase in ferricyanide reduction activity using NADH as an electron donor in microsomes . For N. crassa cytochrome b5 reductase, similar heterologous expression systems could be employed. Alternatively, homologous expression in N. crassa itself might provide a more native protein conformation. The choice of expression system should consider factors such as post-translational modifications, protein folding, and yield requirements.

What purification methods are effective for isolating recombinant NADH-cytochrome b5 reductase?

The M. alpina cytochrome b5 reductase was successfully purified using a multi-step process: solubilization of microsomes with cholic acid sodium salt, followed by DEAE-Sephacel, Mono-Q HR 5/5, and AMP-Sepharose 4B affinity column chromatographies . This procedure resulted in a remarkable 645-fold increase in NADH-ferricyanide reductase specific activity . Similar approaches would likely be effective for N. crassa cytochrome b5 reductase, potentially with adjustments to account for species-specific properties of the enzyme.

What assays can be used to measure NADH-cytochrome b5 reductase activity?

Multiple assay methods can be employed to measure cytochrome b5 reductase activity:

Assay TypeElectron AcceptorDetection MethodAdvantagesLimitations
Ferricyanide ReductionPotassium ferricyanideSpectrophotometric (420 nm)Simple, rapidNon-physiological acceptor
Cytochrome b5 ReductionCytochrome b5Spectrophotometric (424 nm)Physiologically relevantRequires purified cytochrome b5
D-erythroascorbyl Radical ReductionD-erythroascorbyl free radicalESR spectroscopyRelevant to oxidative stress responseSpecialized equipment required
NADH OxidationVariousFluorometric or spectrophotometric (340 nm)Direct measurement of cofactor utilizationMay not distinguish between different NADH-utilizing enzymes

The choice of assay depends on the specific research question and available equipment. For kinetic studies, the ferricyanide reduction assay offers simplicity and reproducibility .

How can I design experiments to study the interaction between NADH-cytochrome b5 reductase and its physiological partners?

To study these interactions, several approaches can be used:

  • Co-immunoprecipitation with antibodies against N. crassa cytochrome b5 reductase to identify interacting proteins

  • Yeast two-hybrid screening using the cytochrome b5 reductase as bait

  • Biolayer interferometry or surface plasmon resonance to measure binding kinetics

  • Reconstitution of purified components in liposomes to study electron transfer in a membrane-like environment

  • Split-GFP or FRET-based assays to visualize protein-protein interactions in vivo

When designing such experiments, it's important to consider the membrane-bound nature of some forms of the enzyme and the potential requirement for lipid environments to maintain proper conformation and activity.

What controls should be included when measuring NADH-cytochrome b5 reductase activity?

Essential controls include:

  • No-enzyme controls to account for non-enzymatic reduction of electron acceptors

  • NADPH substitution for NADH to confirm cofactor specificity (the M. alpina enzyme showed preference for NADH over NADPH)

  • Heat-inactivated enzyme controls

  • Inhibitor controls (e.g., using known inhibitors of cytochrome b5 reductase)

  • Positive controls using commercially available cytochrome b5 reductase from well-characterized sources

Each experiment should include appropriate blank reactions to account for background absorbance or fluorescence of reaction components.

How do I determine kinetic parameters for recombinant NADH-cytochrome b5 reductase?

Kinetic parameters can be determined using the following approach:

  • Measure initial reaction velocities at varying concentrations of NADH (typically 0.01-1 mM) while keeping electron acceptor concentration constant

  • Repeat with varying concentrations of electron acceptor (e.g., ferricyanide) at constant NADH concentration

  • Plot data using Lineweaver-Burk, Eadie-Hofstee, or Hanes-Woolf transformations, or preferably use non-linear regression analysis

  • Calculate Km values for both NADH and electron acceptor, as well as Vmax

  • Determine kcat by dividing Vmax by enzyme concentration

  • Calculate catalytic efficiency using the kcat/Km ratio

Comparing these parameters between wild-type and mutant forms can provide insights into the roles of specific amino acid residues in catalysis.

How can I compare N. crassa NADH-cytochrome b5 reductase with homologs from other species?

Comparative analysis should consider multiple aspects:

  • Sequence alignment to identify conserved and divergent regions

  • Homology modeling based on crystal structures of cytochrome b5 reductases from other species

  • Comparison of kinetic parameters determined under standardized conditions

  • Analysis of substrate specificity profiles

  • Examination of post-translational modifications

  • Comparison of cellular localization patterns

  • Functional complementation experiments (e.g., can the N. crassa gene rescue an S. cerevisiae mcr1 mutant?)

Such comparisons can reveal evolutionary adaptations and species-specific functions of the enzyme.

How might NADH-cytochrome b5 reductase contribute to biomass degradation in N. crassa?

While direct evidence is limited, N. crassa's ability to grow on plant biomass involves complex regulatory networks. The transcriptional regulator rca-1 is involved in lignocellulolytic enzyme synthesis when N. crassa is grown on plant biomass . Transcriptomic analysis revealed that different plant straws (barley, corn, rice, soybean, and wheat) induce overlapping sets of genes in N. crassa . Though not directly implicated, NADH-cytochrome b5 reductase could potentially contribute to redox balance during biomass utilization, particularly under conditions that generate oxidative stress.

What is the relationship between oxidative stress response and lignocellulose degradation in fungi?

Lignocellulose degradation often involves processes that generate reactive oxygen species. For example, in white-rot fungi, lignin degradation proceeds via oxidative mechanisms. Although N. crassa is not typically considered a major lignocellulose degrader, its ability to utilize plant biomass suggests it possesses mechanisms to cope with the oxidative stress associated with this process. NADH-cytochrome b5 reductase, given its role in oxidative stress response in S. cerevisiae , might play a similar protective role in N. crassa during growth on plant biomass.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.