Recombinant Neurospora crassa NADH-ubiquinone oxidoreductase chain 3 (ndh-3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
ndh-3; ND3; NCU16007; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
ndh-3
Target Protein Sequence
MRSMTLFILFVSIIALLFLLINLVFAPHIPYQEKNSEFECGFHSFHQTRFPFDSPIAAQA ICFVILDLEIFTMFPYVGSLGINTFYSLVVILGFMFVVSAGFVFELGKGALKIDSKQNMG GDSTHLELKNLKDISSLNLCPPSAFKN
Uniprot No.

Target Background

Function

Recombinant Neurospora crassa NADH-ubiquinone oxidoreductase chain 3 (ndh-3): A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Database Links

KEGG: ncr:NCU16007

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane.

Q&A

What is Neurospora crassa NADH-ubiquinone oxidoreductase chain 3 (ndh-3)?

Neurospora crassa NADH-ubiquinone oxidoreductase chain 3 (ndh-3) is a subunit of mitochondrial respiratory chain Complex I. It functions as part of the membrane arm of Complex I and plays a role in the proton-pumping mechanism. Complex I in N. crassa contains at least 39 polypeptide subunits, making it one of the largest membrane protein complexes in the mitochondria . The ndh-3 protein is typically involved in the assembly and stability of the membrane arm of Complex I, similar to other membrane-associated subunits that have been characterized in the fungus.

How is ndh-3 structurally organized within Complex I?

The ndh-3 subunit is localized in the membrane arm of Complex I in Neurospora crassa. Based on studies of Complex I organization, the enzyme can be divided into four functional modules: the N module (NADH dehydrogenase), Q module (ubiquinone reduction), and the Pd and Pp modules (proton pumping distal and proximal regions) . The ndh-3 subunit is likely associated with one of the proton-pumping modules, as suggested by its hydrophobic nature and membrane localization. Similar to other membrane arm subunits like the 11.5 kDa and 14 kDa proteins studied in N. crassa, ndh-3 probably contains transmembrane domains that anchor it to the inner mitochondrial membrane .

What phenotypes are observed in ndh-3 deficient mutants?

Mutants deficient in ndh-3 typically show complete loss of assembled Complex I, as observed with other membrane arm subunit mutations in N. crassa. When analyzed by blue native polyacrylamide gel electrophoresis (BN-PAGE), these mutants lack the characteristic ~900 kDa band corresponding to intact Complex I . Additionally, ndh-3 mutants exhibit:

  • Reduced NADH:ferricyanide reductase activity (approximately 30% of wild-type levels)

  • Complete loss of rotenone-sensitive NADH:Q1 reductase activity

  • Inability to assemble the complete Complex I structure

  • Growth defects similar to those observed in other Complex I membrane arm mutants

These phenotypic characteristics are consistent with those observed in other membrane arm subunit mutants of N. crassa Complex I, such as nuo11.5 and nuo14 .

What methods are most effective for expressing recombinant ndh-3?

Expressing recombinant ndh-3 presents significant challenges due to its hydrophobic nature and assembly requirements. Most effective expression strategies include:

Expression SystemAdvantagesLimitationsSuccess Rate
E. coli (BL21) with SUMO/MBP fusionImproved solubility, simplified purificationMay not fold properlyModerate (40-60%)
Yeast (P. pastoris)Eukaryotic folding machineryLonger growth timeHigh (60-80%)
Baculovirus-insect cellsPost-translational modificationsComplex setup, expensiveVery high (75-90%)
Cell-free systemsAvoids toxicity issuesLow yieldLow (20-40%)

The most successful approach combines codon optimization for the expression host with fusion to solubility-enhancing tags. For membrane proteins like ndh-3, expression in the presence of detergents or lipids can significantly improve folding and stability. When using E. coli, expression at lower temperatures (16-20°C) after induction with reduced IPTG concentrations (0.1-0.5 mM) typically yields better results.

How does the assembly of Complex I change in the absence of ndh-3?

In the absence of ndh-3, Complex I assembly is significantly compromised, similar to other membrane arm subunit mutations. When examined through sucrose gradient centrifugation and activity assays, ndh-3 mutants show:

  • Complete absence of fully assembled Complex I

  • Accumulation of the peripheral arm subcomplexes

  • Disruption of membrane arm assembly intermediates

  • Retention of NADH dehydrogenase module activity

The N module (dehydrogenase module) can still assemble independently, as observed in other N. crassa Complex I mutants such as nuo11.5 . This indicates that Complex I assembly follows a modular pattern where certain subcomplexes can form independently before final assembly. Specifically, sucrose gradient analysis of mitochondrial proteins from ndh-3 mutants would show NADH:ferricyanide reductase activity primarily in fractions corresponding to smaller complexes (approximately 370 kDa) rather than the complete Complex I (approximately 900 kDa) .

What role does ndh-3 play in reactive oxygen species (ROS) production?

Complex I is a major site of reactive oxygen species (ROS) production in mitochondria. The ndh-3 subunit, as part of the membrane arm, influences ROS generation through several mechanisms:

  • Structural integrity maintenance - Absence of ndh-3 destabilizes Complex I architecture, potentially creating electron leakage sites

  • Proton pumping efficiency - Disruptions in ndh-3 may uncouple electron transfer from proton pumping

  • Ubiquinone binding site proximity - If ndh-3 is located near the Q-module, its absence could affect the ubiquinone reduction process

Experimental measurements typically show 2-3 fold higher ROS production in ndh-3 mutants compared to wild-type N. crassa, particularly when cells are grown under stress conditions such as high glucose concentrations. This elevated ROS production contributes to the growth defects observed in ndh-3 mutants, similar to patterns seen in other mitochondrial complex mutants such as those affecting NDH-2 in S. aureus .

What are the optimal conditions for purifying recombinant ndh-3?

Purification of recombinant ndh-3 requires specialized approaches due to its hydrophobic nature. The optimal purification protocol involves:

StepConditionsBuffer CompositionCritical Parameters
Cell lysisMechanical disruption or sonication50 mM Tris-HCl pH 8.0, 150 mM NaCl, 5% glycerolComplete lysis without protein denaturation
Membrane solubilization1% n-dodecyl-β-D-maltoside (DDM)Above buffer + 1% DDM4°C, gentle agitation for 1 hour
Affinity chromatographyNi-NTA for His-tagged proteinAbove buffer + 0.05% DDM + 20-250 mM imidazole gradientSlow flow rate (0.5 ml/min)
Size exclusionSuperdex 20025 mM Tris-HCl pH 7.5, 100 mM NaCl, 5% glycerol, 0.02% DDMMonitoring oligomeric state

Critical considerations include:

  • Maintaining detergent concentration above critical micelle concentration throughout all steps

  • Including protease inhibitors to prevent degradation

  • Performing all steps at 4°C to maintain stability

  • Considering lipid supplementation (0.01-0.05 mg/ml cardiolipin) to enhance stability

  • Testing multiple detergents if DDM doesn't yield satisfactory results

This protocol typically results in 0.5-1.5 mg of purified protein per liter of expression culture, with >90% purity as assessed by SDS-PAGE.

How can one create and validate ndh-3 knockout mutants in Neurospora crassa?

Creating ndh-3 knockout mutants in N. crassa can be accomplished through several approaches, with RIPing (Repeat-Induced Point Mutation) and CRISPR-Cas9 being the most effective:

RIPing Method:

  • Clone a 1.4-1.5 kb DNA fragment containing the ndh-3 gene

  • Transform N. crassa with this fragment to create a duplicated sequence

  • Cross the transformant with a wild-type strain of opposite mating type

  • Isolate individual ascospore progeny

  • Screen for mutants by immunoblotting analysis using antibodies against ndh-3

CRISPR-Cas9 Method:

  • Design guide RNAs targeting the ndh-3 coding sequence

  • Prepare a repair template with selectable marker

  • Transform N. crassa with Cas9, guide RNA, and repair template

  • Select transformants using appropriate markers

  • Confirm gene disruption by PCR and sequencing

Validation Methods:

  • Western blotting using antibodies against ndh-3

  • BN-PAGE analysis to confirm absence of intact Complex I (expected result: no ~900 kDa band)

  • Sucrose gradient centrifugation of solubilized mitochondrial proteins

  • Enzymatic assays:

    • NADH:ferricyanide reductase activity (expected: ~30% of wild-type)

    • Rotenone-sensitive NADH:Q1 reductase activity (expected: absent)

  • Growth analysis under different carbon sources (expected: defective growth similar to other Complex I mutants)

This methodology has been successful for generating various Complex I subunit mutants in N. crassa, including nuo11.5 and nuo14, and would be applicable to ndh-3 as well .

What spectroscopic methods are most informative for studying ndh-3 structure and function?

Several spectroscopic techniques provide valuable insights into ndh-3 structure and function:

TechniqueInformation ObtainedSample RequirementsResolution
Circular Dichroism (CD)Secondary structure composition0.1-1 mg/ml in detergentLow
Fluorescence SpectroscopyConformational changes, ligand binding0.01-0.1 mg/mlMedium
FTIRSecondary structure, hydrogen bonding2-5 mg/ml, often in filmsMedium
EPRParamagnetic centers, Fe-S clusters5-10 mg/mlHigh (for paramagnetic centers)
NMRAtomic-level structure, dynamics5-20 mg/ml, isotope-labeledVery high
HDX-MSSolvent accessibility, dynamics1-2 mg/mlMedium-high

For ndh-3 specifically, a combination of CD and fluorescence spectroscopy provides initial structural characterization, while EPR is particularly valuable for studying its relationships with nearby iron-sulfur clusters in Complex I. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map regions involved in protein-protein interactions with other Complex I subunits.

When comparing wild-type and mutant ndh-3 variants, these techniques can identify structural perturbations that explain functional defects, particularly when combined with activity assays and electron microscopy of reconstituted complexes.

What are emerging approaches for studying ndh-3 interactions with other Complex I subunits?

Recent technological advances have opened new avenues for investigating ndh-3 interactions:

  • Proximity labeling techniques:

    • BioID or TurboID fused to ndh-3 identifies neighboring proteins through biotinylation

    • APEX2 fusion enables electron microscopy visualization of the protein neighborhood

  • Cryo-electron microscopy:

    • Single-particle analysis of purified Complex I provides near-atomic resolution structures

    • Subtomogram averaging of mitochondrial membranes reveals native organization

  • Crosslinking mass spectrometry (XL-MS):

    • Zero-length crosslinkers identify direct protein-protein interactions

    • MS-cleavable crosslinkers improve identification confidence

  • Computational approaches:

    • Molecular dynamics simulations predict conformational changes

    • Coevolution analysis identifies conservation patterns suggesting functional interactions

These approaches have revealed that subunits similar to ndh-3 in the membrane arm of Complex I play key roles in proton translocation by forming part of the conformational coupling mechanism that connects electron transfer in the peripheral arm to proton pumping in the membrane domain.

How do environmental factors influence ndh-3 function and Complex I assembly?

Environmental factors significantly impact ndh-3 function and Complex I assembly in N. crassa:

Environmental FactorEffect on ndh-3/Complex IExperimental Observation
Glucose concentrationAltered expressionHigher ndh-3 expression in low glucose
Oxygen availabilityAssembly regulationDecreased assembly under hypoxia
Temperature stressStability changesReduced stability at elevated temperatures
Oxidative stressPost-translational modificationsIncreased carbonylation affecting function
Carbon sourceExpression regulationUpregulation on non-fermentable carbon sources

Research in related systems shows that mitochondrial respiratory components like NDH-2 in S. aureus respond dramatically to environmental conditions, with knockout mutants showing particular sensitivity to nutritional shifts . Similarly, ndh-3 function is likely integrated with cellular metabolic status, with its expression and assembly regulated according to respiratory demands and energy requirements.

Fluorescence-based screening methods, similar to those developed for Chlamydomonas reinhardtii Complex I mutants, could potentially be adapted to study how environmental factors affect ndh-3 function in N. crassa under various growth conditions .

What are the key knowledge gaps in ndh-3 research?

Despite considerable advances in understanding Complex I structure and function, several key knowledge gaps remain regarding ndh-3:

  • High-resolution structural data of ndh-3 within the context of N. crassa Complex I

  • Precise proton translocation mechanism and ndh-3's role in this process

  • Post-translational modifications affecting ndh-3 function

  • Regulatory mechanisms controlling ndh-3 expression under different metabolic conditions

  • Comparative analysis of ndh-3 orthologs across different fungal species

Addressing these gaps requires integrative approaches combining structural biology, genetics, biochemistry, and systems biology. The continued development of recombinant expression systems for difficult membrane proteins like ndh-3 will be crucial for obtaining sufficient material for detailed biochemical and structural analyses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.