Recombinant Neurospora crassa NADH-ubiquinone oxidoreductase chain 6 (ndh-6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndh-6; ND6; NCU16004; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
ndh-6
Target Protein Sequence
MNSLFLINESFTNGYISSVLDIISILAIFCGISVIVNKNPIISVLFLIGLFASVSSYLIL LGLSFIGLAYLIVYIGAISILFLFILMLINIRISELQSNTNNSIPLTIILGISLSYSLFQ LLPYDIAILSNFSSNINNNLYNLSMNKQNNGNFGINTTPAVSLQPKNNDLLFVTSKIWDG NLAESNHITTIGNVMYSNYSIWLFLASFILLLAMVGSIVIIMKSNASWGGALPNTRETKT EGR
Uniprot No.

Target Background

Function

Recombinant Neurospora crassa NADH-ubiquinone oxidoreductase chain 6 (NDH-6): A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly required for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Database Links

KEGG: ncr:NCU16004

Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional role of ndh-6 in Neurospora crassa complex I?

NADH-ubiquinone oxidoreductase chain 6 (ndh-6) is a subunit of the mitochondrial respiratory complex I in Neurospora crassa. Complex I has an L-shaped structure consisting of a peripheral arm and a membrane arm. The peripheral arm contains FMN and multiple iron-sulfur clusters that form the NADH dehydrogenase segment of the electron transport pathway. The membrane arm, where ndh-6 is located, contains at least one iron-sulfur cluster and constitutes the ubiquinone reducing segment of the complex . This arrangement facilitates the electron transfer from NADH to coenzyme Q10 (CoQ10) across the inner mitochondrial membrane .

To properly study ndh-6's specific role, researchers typically employ comparative structural biology approaches using techniques such as cryo-electron microscopy or X-ray crystallography, combined with site-directed mutagenesis to probe functional domains. When investigating membrane proteins like ndh-6, detergent solubilization optimization is critical for maintaining structural integrity during purification.

What genetic approaches can be used to study ndh-6 function in Neurospora crassa?

The most effective genetic approach for studying ndh-6 in N. crassa involves homologous gene replacement with a defective gene copy, similar to methods used for other complex I subunits . This technique allows for the creation of knockout mutants to analyze the functional consequences of ndh-6 deletion.

A methodological workflow should include:

  • PCR amplification of the ndh-6 gene with flanking regions (typically 1-1.5 kb upstream and downstream)

  • Introduction of a selective marker (such as sulfonylurea resistance) into the construct

  • Transformation of N. crassa using protoplast transformation protocols

  • Selection of transformants using appropriate antibiotics (e.g., chlorimuron ethyl at 15 μg/ml)

  • Serial transfers on selective media to favor homokaryon formation

  • PCR verification of successful gene replacement

This approach, successfully employed for other genes in N. crassa, allows researchers to generate mutants that can be further characterized through biochemical and phenotypic analysis .

How does complex I assembly occur in Neurospora crassa and what role does ndh-6 play?

Complex I assembly in N. crassa follows a modular pathway in which the peripheral arm and membrane arm are assembled independently before joining to form the complete complex. The peripheral arm containing the NADH dehydrogenase segment assembles with all its redox groups first. Simultaneously but separately, the membrane arm containing the ubiquinone reducing segment, which includes ndh-6, undergoes its own assembly process .

Research methodology to investigate this process should include:

  • Sequential isolation of assembly intermediates using blue native gel electrophoresis

  • Characterization of protein composition using mass spectrometry

  • Assessment of enzymatic activities of partially assembled complexes

  • Pulse-chase experiments to track assembly kinetics

  • Comparative studies between wild-type and knockout strains

Studies have shown that disruption of genes encoding membrane arm subunits can block the final assembly of the membrane arm while still allowing assembly of the peripheral arm . This results in accumulation of assembly intermediates that can provide valuable insights into the assembly pathway. One notable finding is that some assembly intermediates contain proteins that are not present in the fully assembled complex I, suggesting the involvement of assembly factors.

How does the respiratory phenotype of ndh-6 deletion mutants compare with other complex I mutants in Neurospora crassa?

Based on studies of related complex I subunit mutations, ndh-6 deletion mutants would likely show significant respiratory defects but may still maintain some growth capability. When the gene for the 51-kDa NADH-binding subunit was inactivated, the resulting mutant (nuo51) lacked complex I activity but still grew at one-third of the wild-type growth rate . This was due to compensatory upregulation of alternative NADH:ubiquinone oxidoreductase activities.

For rigorous comparative assessment of respiratory phenotypes, researchers should implement:

  • Growth rate measurements under various carbon sources (glucose, acetate, glycerol)

  • Oxygen consumption measurements using high-resolution respirometry

  • Enzymatic activity assays for all respiratory chain complexes

  • Membrane potential measurements in isolated mitochondria

  • Metabolomic analysis of central carbon metabolism intermediates

The comparative data would typically reveal patterns as shown in this representative table based on similar complex I mutant studies:

ParameterWild-typendh-6 mutantnuo51 mutant
Growth rate (μm/h)100%20-40%*33%
Complex I activity100%0-5%*0%
Alternative NADH dehydrogenase activity100%200-250%*200%
Complex III activity100%90-110%*100%
Complex IV activity100%90-110%*100%

*Predicted values based on similar complex I subunit mutations

This comparative approach allows researchers to understand the specific contributions of ndh-6 to respiratory function and the compensatory mechanisms that may be activated in its absence.

What role does the RIP (Repeat-Induced Point mutation) mechanism play in studying recombinant ndh-6 expression in Neurospora crassa?

RIP (Repeat-Induced Point mutation) is a genome defense mechanism in N. crassa that detects and mutates duplicated DNA sequences during the sexual cycle. This presents significant challenges for researchers working with recombinant ndh-6, as introducing additional copies of the gene could trigger RIP, resulting in mutation of both the introduced and endogenous copies .

To overcome this methodological challenge, researchers should:

  • Use heterologous expression systems (like E. coli or yeast) for protein production when high yields are needed

  • If expression must be done in N. crassa, use RIP-deficient strains (if available)

  • Design expression constructs with codon optimization to reduce sequence similarity

  • Utilize inducible promoters to minimize the time during which multiple copies are present

  • Validate the sequence integrity of both endogenous and recombinant genes after transformation

The RIP mechanism effectively prevents gene duplication as an evolutionary mechanism in N. crassa, making it uniquely "frozen" in evolutionary terms compared to other fungi. This characteristic has implications for comparative studies of ndh-6 across fungal species, as N. crassa may retain more ancestral features of the complex I structure .

How can transcriptomic approaches be used to analyze the impact of ndh-6 deletion on respiratory chain assembly and function?

Transcriptomic analysis provides valuable insights into the compensatory mechanisms and regulatory networks affected by ndh-6 deletion. A comprehensive methodology should include:

  • RNA isolation from both wild-type and ndh-6 deletion strains under identical growth conditions

  • RNA-Seq analysis using next-generation sequencing platforms

  • Bioinformatic processing following standardized workflows:

    • Quality control of raw reads

    • Mapping to N. crassa genome

    • Expression quantification using RPKM (Reads per kb per million reads)

    • Differential expression analysis (fold change >2, FDR <0.001)

    • Filtering of low abundance transcripts (RPKM <12)

  • RT-qPCR validation of key differentially expressed genes

  • Time-course experiments to capture dynamic responses

Based on similar studies of respiratory chain mutants in N. crassa, researchers would expect to see differential expression of genes involved in alternative respiratory pathways, assembly factors, and stress response mechanisms . The data could be presented in tables similar to the one shown in search result , highlighting the transcriptional changes in key genes across different time points and conditions.

What are the methodological challenges in purifying and characterizing recombinant ndh-6 protein, and how can they be overcome?

Purification and characterization of recombinant ndh-6 present significant challenges due to its hydrophobic nature and integration within the membrane arm of complex I. A comprehensive methodology to address these challenges includes:

  • Expression system selection:

    • Heterologous expression in E. coli often leads to inclusion body formation

    • Expression in yeast systems like P. pastoris may improve membrane integration

    • N. crassa expression may provide proper folding but with lower yields

  • Solubilization optimization:

    • Systematic screening of detergents (DDM, digitonin, LMNG)

    • Detergent-to-protein ratio optimization

    • Buffer composition adjustments (salt concentration, pH)

  • Purification strategy:

    • Affinity chromatography using engineered tags (His, FLAG)

    • Size exclusion chromatography to preserve native-like state

    • Activity-based purification monitoring

  • Structural and functional characterization:

    • Native PAGE to assess oligomeric state

    • Circular dichroism for secondary structure analysis

    • Reconstitution into liposomes for functional assays

    • Single-molecule techniques for interaction studies

Each of these steps requires careful optimization and validation to ensure the recombinant protein maintains its structural integrity and functional properties.

What are the optimal conditions for measuring NADH:ubiquinone oxidoreductase activity in Neurospora crassa mitochondrial preparations?

Accurate measurement of NADH:ubiquinone oxidoreductase activity requires careful isolation of mitochondria and optimized assay conditions. A comprehensive methodology includes:

  • Mitochondrial isolation:

    • Grow N. crassa under standardized conditions (Vogel's medium, 28°C)

    • Harvest mycelia by filtration during exponential growth phase

    • Homogenize in isolation buffer containing protease inhibitors

    • Differential centrifugation to obtain pure mitochondrial fraction

    • Assess mitochondrial integrity (respiratory control ratio)

  • Enzymatic activity assay:

    • Buffer composition: 50 mM phosphate buffer, pH 7.4, 1 mM EDTA

    • Substrate concentrations: 100-200 μM NADH, 50-100 μM ubiquinone

    • Inhibitor controls: 2-5 μM rotenone (complex I specific inhibitor)

    • Temperature: 30°C for optimal enzyme kinetics

    • Spectrophotometric measurement at 340 nm (NADH oxidation)

  • Data analysis:

    • Calculate specific activity normalized to protein content

    • Determine kinetic parameters (Km, Vmax) for both substrates

    • Assess inhibitor sensitivity (IC50 values)

    • Compare with alternative NADH dehydrogenase activity

When comparing wild-type and mutant strains, it's essential to distinguish between complex I-specific activity and alternative NADH dehydrogenase activities. Studies have shown that in complex I mutants, alternative NADH:ubiquinone oxidoreductase activity can increase up to twofold as a compensatory mechanism .

How can iron-sulfur cluster assembly and incorporation into ndh-6 be studied experimentally?

Iron-sulfur clusters are essential for electron transfer within complex I, including the membrane arm where ndh-6 is located. Studying their assembly and incorporation requires specialized techniques:

  • EPR spectroscopy:

    • Preparation of samples under anaerobic conditions

    • Low-temperature measurements (typically 10-30K)

    • Identification of specific iron-sulfur cluster signatures

    • Quantification of cluster content

  • Mössbauer spectroscopy:

    • Growth with 57Fe isotope enrichment

    • Sample preparation under non-oxidizing conditions

    • Data collection at various temperatures

    • Analysis of isomer shifts and quadrupole splittings

  • In vitro reconstitution:

    • Purification of apo-proteins under anaerobic conditions

    • Controlled reconstitution with iron and sulfide

    • Activity measurements before and after reconstitution

    • Structural validation of reconstituted proteins

  • Genetic approaches:

    • Mutation of coordinating residues

    • Analysis of assembly intermediates

    • Complementation studies with wild-type genes

Previous studies have shown that complex I contains multiple EPR-detectable iron-sulfur clusters, including cluster N-3 which is bound to the 51-kDa NADH-binding subunit . Similar approaches can be applied to study iron-sulfur clusters associated with ndh-6 and their role in electron transfer within the membrane arm of complex I.

How does ndh-6 deletion affect cellular responses to oxidative stress in Neurospora crassa?

Complex I dysfunction typically leads to increased reactive oxygen species (ROS) production and altered oxidative stress responses. To study this relationship systematically:

  • Oxidative stress susceptibility assessment:

    • Grow wild-type and ndh-6 mutant strains on media containing oxidants

    • Measure growth inhibition with H2O2 (1-10 mM) and menadione (5-50 μg/ml)

    • Calculate relative growth inhibition rates based on colony diameters

    • Analyze time-dependent responses (24-48h)

  • ROS detection methods:

    • Fluorescent probes (DCF-DA, MitoSOX) for localized ROS measurement

    • Protein carbonylation assays for oxidative damage assessment

    • Lipid peroxidation measurement (MDA levels)

    • Glutathione redox state determination

  • Antioxidant enzyme activity measurements:

    • Catalase activity (H2O2 decomposition)

    • Superoxide dismutase (SOD) activity

    • Glutathione peroxidase and reductase activities

    • Quantification of low molecular weight antioxidants

Based on studies of other mitochondrial mutants, we would expect ndh-6 deletion to affect oxidative stress responses similar to patterns observed in the susceptibility tests reported for other N. crassa mutants . This could involve altered expression and activity of antioxidant enzymes as compensatory mechanisms.

What methodological approaches can be used to study the integration of ndh-6 into the membrane arm of complex I?

Studying the integration of ndh-6 into the membrane arm requires specialized approaches for membrane protein analysis:

  • Blue native gel electrophoresis:

    • Solubilization of mitochondrial membranes with mild detergents

    • Separation of intact complexes and assembly intermediates

    • Western blot detection of ndh-6 and other complex I subunits

    • Identification of subcomplexes containing ndh-6

  • Selective solubilization experiments:

    • Differential detergent treatments to identify stable subcomplexes

    • Antibody pull-down of specific subunits

    • Mass spectrometry analysis of co-purifying proteins

    • Identification of direct interaction partners

  • Chemical crosslinking:

    • In organello crosslinking with various spacer lengths

    • Identification of crosslinked products by immunoblotting

    • Mass spectrometry analysis of crosslinked peptides

    • Mapping of spatial relationships between subunits

  • Pulse-chase experiments:

    • Radioactive labeling of newly synthesized proteins

    • Tracking incorporation into assembly intermediates

    • Time-course analysis of complex formation

    • Comparison between wild-type and mutant strains

These approaches have revealed that complex I assembly in N. crassa involves independent assembly of the peripheral and membrane arms, with specific assembly factors guiding the process . Understanding ndh-6 integration would provide further insights into the assembly pathway of the membrane arm.

How does the structure and function of ndh-6 in Neurospora crassa compare with homologous proteins in other fungal species?

Comparative analysis of ndh-6 across fungal species provides valuable evolutionary insights. A comprehensive methodology includes:

  • Sequence analysis:

    • Multiple sequence alignment of ndh-6 homologs

    • Phylogenetic tree construction using maximum likelihood methods

    • Identification of conserved domains and residues

    • Selection pressure analysis (dN/dS ratios)

  • Structural comparison:

    • Homology modeling based on available structures

    • Conservation mapping onto structural models

    • Analysis of membrane topology and transmembrane regions

    • Identification of functional motifs and their conservation

  • Functional complementation:

    • Cross-species gene replacement experiments

    • Analysis of complementation efficiency

    • Identification of species-specific functions

    • Investigation of co-evolutionary patterns with interacting subunits

N. crassa presents a unique case in fungal evolution due to its RIP mechanism, which has effectively halted gene duplication as an evolutionary mechanism . This means that ndh-6 in N. crassa has likely evolved differently compared to homologs in other fungi that could undergo duplication and neofunctionalization. Researchers should carefully consider this evolutionary constraint when interpreting comparative data.

What bioinformatic tools and databases are most appropriate for analyzing ndh-6 sequence, structure, and interactions?

Proper bioinformatic analysis requires selecting appropriate tools and databases:

  • Sequence analysis tools:

    • BLAST and HMMER for homolog identification

    • Clustal Omega or MUSCLE for multiple sequence alignment

    • MEGA or RAxML for phylogenetic analysis

    • PAML for selection pressure analysis

  • Structural analysis tools:

    • TMHMM or TOPCONS for transmembrane prediction

    • I-TASSER or AlphaFold for protein structure prediction

    • PyMOL or UCSF Chimera for structural visualization

    • ConSurf for evolutionary conservation mapping

  • Relevant databases:

    • UniProt for curated protein information

    • PFAM for protein domain information

    • PDB for experimental structural data

    • KEGG or BioCyc for metabolic pathway context

  • Interaction prediction tools:

    • STRING for protein-protein interaction networks

    • STITCH for protein-chemical interactions

    • Coevolution analysis using methods like GREMLIN

    • Molecular docking simulations for specific interactions

When analyzing ndh-6, researchers should pay particular attention to membrane protein-specific tools and databases, as the hydrophobic nature of this protein presents unique challenges for bioinformatic analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.