Recombinant Neurospora crassa Palmitoyltransferase PFA3 (pfa-3)

Shipped with Ice Packs
In Stock

Description

Functional Role in pH Signaling

PFA3 is part of the pal gene family regulated by the pH-responsive transcription factor PAC-3 . Key functional insights include:

  • Regulation by PAC-3: PAC-3 binds directly to the pfa-3 promoter, modulating its expression under alkaline pH stress .

  • Metabolic Impact: PFA3-mediated palmitoylation influences enzyme localization and activity during adaptive responses to environmental pH changes .

  • Interaction Network: Associates with mitochondrial and plasma membrane proteins, suggesting roles in stress signaling and lipid metabolism .

Recombinant Production and Applications

Table 2: Expression and Purification Protocols

ParameterDetail
Host SystemE. coli or Neurospora crassa
Tagging SystemStrep-tag® or histidine tags for affinity purification
Purity>85% (verified by SDS-PAGE)
Storage ConditionsTris-based buffer with 50% glycerol; stable at -80°C

Recombinant PFA3 is utilized to study fungal lipid metabolism, protein acylation mechanisms, and pH adaptation pathways. Its activity is critical for understanding stress responses in pathogenic fungi .

Research Findings and Mutant Analysis

  • Mutant Phenotypes: Deletion of pfa-3 results in altered lipid profiles and reduced tolerance to pH fluctuations, confirming its role in stress adaptation .

  • Enzymatic Activity: Recombinant PFA3 exhibits higher catalytic efficiency when produced in N. crassa compared to E. coli, likely due to native post-translational modifications .

  • Pathway Integration: PFA3 works synergistically with other pH signaling components (e.g., PAL-9) to regulate melanin biosynthesis and hyphal growth under alkaline conditions .

Implications for Biotechnology and Medicine

  • Biofuel Research: PFA3-linked lipid modifications influence cellulase efficiency, relevant to lignocellulosic biomass degradation .

  • Antifungal Targets: As a pH-regulated enzyme, PFA3 is a potential target for disrupting fungal pathogenicity .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare it according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ptr-3; pfa3; B13M13.170; NCU01267; Palmitoyltransferase pfa3; Palmitoyltransferase 3; Protein fatty acyltransferase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-598
Protein Length
full length protein
Species
Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
Target Names
ptr-3
Target Protein Sequence
MARRWARKLERYCCTCVTYFPLAFVYSMTSWAAYVDVSLSTTPSRVTWLGHSYGFIAVVL YLLANWCYTYAVFTSPGSTTNEYGYSTLPTQAPPTATSFTVKSNGEFRFCKKCQARKPDR AHHCSTCRRCVLKMDHHCPWLATCVGLRNHKAFLLFLIYTSVFCWVSFAGSASWVWEEIM SNTTYVETLMPVNYIMLSVISGIIGIVLSAFCGWHIYLASRGQTTIECLEKTRYLSPLRE SMQRTYVNQHTPGQGIALPKYGQQLLDIHQNTIPGVTRPEEGEEMRRMTTPSGSSQRNDL ASQHNPELQAGSRRFTYDEMEHIRARKRYEDYLDEQDSTKLPHAFDLGTPRNLLHLFGTN AWLWPFPVCTTIGDGWSWEPNPKWIEARDRIAREREEQRQRERQAGWGPADDDDITPVYT PTWTPPNQQHPQGGAGRHYLQPSSQPQTQRNSNSSSPSFTPSRRTPSKADRILGRDPNMY ADDEPVIYGKHDVAMSRLSPAGRTLVVEDDVLNDDDDDDEDYFQDAGRKQEDAEQSALNV VTNGRWGRPAGASGVGLLAHGRPGGARSPISPISPPARGFGGSAKNGEEGRSNDDGVD
Uniprot No.

Target Background

Function
Palmitoyltransferase specific for Vac8. Palmitoylates Vac8 at one or more of its N-terminal cysteine residues, which is essential for its proper membrane localization.
Database Links

KEGG: ncr:NCU01267

Protein Families
DHHC palmitoyltransferase family, PFA3 subfamily
Subcellular Location
Vacuole membrane; Multi-pass membrane protein.

Q&A

How was the pfa-3 mutant identified and characterized in Neurospora research?

The pfa-3 mutant was identified through a systematic screening process designed to isolate mutants with altered fatty acid metabolism. Researchers treated Neurospora crassa conidia with various mutagens including γ-irradiation, then screened for strains requiring unsaturated fatty acid supplementation for growth. Further characterization involved assessing the ability of these mutants to synthesize fatty acids de novo using [14C]acetate labeling .

From hundreds of screened colonies, 44 showed requirements for unsaturated fatty acid supplementation at 15°C. Upon further screening with [14C]acetate incorporation assays, five lines demonstrated significantly reduced synthesis of polyunsaturated fatty acids and were designated as pfa mutants, with pfa-3 being one of these five distinct mutants .

What distinctive biochemical phenotype is observed in the pfa-3 mutant?

The pfa-3 mutant demonstrates a remarkably distinctive biochemical phenotype compared to other pfa mutants and wild-type Neurospora. Experimental data show that pfa-3 incorporates an extremely high proportion of acetate- or oleate (18:1)-derived labels into free fatty acids rather than into complex lipids. Quantitatively, pfa-3 cultures contain approximately eight times the wild-type level of free fatty acids relative to triglycerides .

This significant alteration in lipid metabolism suggests that PFA3 plays a crucial role in the incorporation of fatty acids into complex lipids, with its absence resulting in an accumulation of free fatty acids that cannot be properly utilized by the cell.

How does the fatty acid composition differ between wild-type and pfa-3 mutant strains?

The composition of free fatty acids differs substantially between wild-type and pfa-3 mutant strains:

Fatty AcidWild-type (%)pfa-3 Mutant (%)
16:0 (Palmitic acid)38%15%
18:3 (α-Linolenic acid)10%37%

These data indicate that the pfa-3 mutation significantly alters not just the quantity but also the composition of free fatty acids in the cell. The substantial increase in 18:3 (α-linolenic acid) and decrease in 16:0 (palmitic acid) in the free fatty acid pool suggests that PFA3 may be specifically involved in the utilization or metabolism of polyunsaturated fatty acids in Neurospora crassa .

What expression systems are optimal for producing recombinant Neurospora crassa PFA3?

For recombinant production of PFA3, Escherichia coli expression systems have been successfully employed. The recommended approach involves expressing the full-length protein (1-598 amino acids) with an N-terminal histidine tag to facilitate purification. This method allows for the isolation of functional protein suitable for biochemical characterization and activity assays .

The E. coli expression system offers several advantages for PFA3 production:

  • Relatively high protein yields

  • Established protocols for induction and purification

  • Compatibility with N-terminal His-tagging

  • Ability to produce full-length protein with preserved functionality

For researchers requiring purified protein for enzymatic assays or structural studies, expressing PFA3 in E. coli followed by affinity chromatography using the His-tag represents the most efficient approach based on current literature .

How can [14C]acetate incorporation be used to assess fatty acid synthesis in PFA3 studies?

Radiolabeling with [14C]acetate provides a powerful method for tracking de novo fatty acid synthesis and metabolism in Neurospora crassa. This technique was instrumental in characterizing the pfa mutants, including pfa-3.

Methodology:

  • Grow Neurospora cultures under controlled conditions (typically at 15°C or 23°C)

  • Add [14C]acetate to the growth medium

  • Allow incorporation for a defined period (typically 24 hours)

  • Extract total lipids using chloroform-methanol extraction

  • Fractionate lipids to separate different lipid classes (free fatty acids, triglycerides, phospholipids)

  • Methylate fatty acids to form fatty acid methyl esters (FAMEs)

  • Separate FAMEs by high-performance liquid chromatography (HPLC)

  • Detect radioactivity using a radiodetector

  • Calculate relative incorporation into different fatty acid species

This method allows researchers to determine specifically which fatty acid synthesis pathways are affected by mutations in pfa genes, providing insights into their biochemical functions .

How does PFA3 relate to membrane biology in Neurospora crassa?

While direct evidence is limited in the provided search results, the patterns observed in pfa-3 mutants suggest that PFA3 plays a significant role in membrane lipid metabolism. The altered distribution of fatty acids between free and membrane-incorporated forms in the pfa-3 mutant indicates that this protein may be involved in processes that regulate the incorporation of specific fatty acids, particularly polyunsaturated fatty acids, into membrane lipids .

The high levels of free fatty acids in pfa-3 mutants, combined with altered ratios of saturated to unsaturated fatty acids, suggest that PFA3 may function in maintaining proper membrane composition and fluidity. This is particularly important for fungi like Neurospora crassa that must adapt to varying environmental conditions, where membrane fluidity adjustments through fatty acid composition are critical adaptation mechanisms .

Does PFA3 function intersect with glycosphingolipid biosynthesis in Neurospora?

While the direct relationship between PFA3 and glycosphingolipid (GSL) biosynthesis is not explicitly documented in the search results, there are potential intersections between these pathways. In Neurospora crassa, GSL biosynthesis begins with serine palmitoyltransferase activity, which catalyzes the condensation of serine with palmitoyl-CoA .

Given that PFA3 is classified as a palmitoyltransferase and pfa-3 mutants show altered fatty acid metabolism, there may be regulatory or metabolic connections between PFA3 function and GSL biosynthesis. Both pathways utilize fatty acid precursors and may compete for the same substrate pool, suggesting possible regulatory interactions .

Research investigating potential cross-talk between these pathways would represent an important direction for future studies, particularly examining whether pfa-3 mutations affect GSL levels or composition.

How might genomic resequencing approaches be applied to further characterize pfa-3 and related mutants?

Genomic resequencing represents a powerful approach for definitively identifying the genetic basis of classical mutant phenotypes in Neurospora crassa. As demonstrated with other biochemical mutants in Neurospora, next-generation sequencing can rapidly and economically connect phenotypes to specific genetic loci .

For pfa-3 and related fatty acid metabolism mutants, this approach could:

  • Confirm the precise genetic location of the pfa-3 mutation

  • Identify any secondary mutations that might contribute to the observed phenotype

  • Reveal potential regulatory elements affecting PFA3 expression

  • Enable comparative analysis with other pfa mutants to understand pathway relationships

The methodology would involve:

  • Isolating high-quality genomic DNA from the pfa-3 mutant strain

  • Performing whole-genome shotgun sequencing using short-read technology

  • Mapping reads to the Neurospora crassa reference genome

  • Identifying variants (SNPs, indels, structural variants)

  • Filtering variants to identify those most likely to cause the observed phenotype

  • Validating candidate mutations through complementation testing

What experimental approaches can determine PFA3's specific enzymatic activity and substrates?

Determining the precise enzymatic activity of PFA3 requires multiple complementary approaches:

  • In vitro enzymatic assays: Using purified recombinant PFA3 protein with various potential substrates (acyl-CoAs of different chain lengths and saturation) to measure palmitoyltransferase activity.

  • Metabolomic profiling: Comparing the lipidome of wild-type and pfa-3 mutant strains using liquid chromatography-mass spectrometry (LC-MS) to identify accumulating substrates or depleted products.

  • Protein-substrate binding assays: Utilizing techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to measure binding affinities between PFA3 and potential substrates.

  • Structure-function analysis: Creating site-directed mutants of conserved residues in the PFA3 catalytic domain to establish the molecular basis of substrate recognition and catalysis.

  • Complementation studies: Introducing wild-type PFA3 or mutated versions into pfa-3 mutant strains to determine which domains or activities are essential for function in vivo .

What are the consequences of pfa-3 mutation on Neurospora growth and development?

The pfa-3 mutation profoundly affects Neurospora crassa physiology, necessitating supplementation with unsaturated fatty acids for normal growth. This requirement indicates that PFA3 is essential for the normal metabolism of polyunsaturated fatty acids, particularly α-linolenic acid (18:3) .

While specific growth parameters for pfa-3 mutants are not fully detailed in the available search results, evidence from research on other lipid metabolism mutants in Neurospora suggests that defects in this pathway can affect:

  • Hyphal morphology and growth rate

  • Conidiation (asexual reproduction)

  • Sexual development and fertility

  • Membrane integrity and function

  • Response to environmental stresses, particularly temperature stress

The requirement for fatty acid supplementation in pfa-3 mutants underscores the critical role of polyunsaturated fatty acids in fungal physiology and the importance of enzymes like PFA3 in maintaining proper lipid homeostasis.

How does temperature affect PFA3 function and fatty acid metabolism in Neurospora?

Temperature plays a crucial role in the phenotypic expression of pfa mutations in Neurospora crassa. The initial screening and characterization of pfa mutants was conducted at 15°C, indicating that the requirement for unsaturated fatty acid supplementation is particularly evident at lower temperatures .

This temperature sensitivity likely reflects the critical role of polyunsaturated fatty acids in maintaining membrane fluidity at reduced temperatures. As environmental temperature decreases, organisms typically increase the proportion of unsaturated fatty acids in their membranes to maintain appropriate fluidity and function. The inability of pfa-3 mutants to properly process or incorporate polyunsaturated fatty acids likely exacerbates growth defects at lower temperatures .

Research protocols examining PFA3 function should consider temperature as a critical variable, as phenotypic effects may be more pronounced or only detectable within specific temperature ranges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.